BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= brP-0332 (824 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AB244761-1|BAE66603.1| 504|Apis mellifera cystathionine beta-sy... 28 0.12 AY569707-1|AAS86660.1| 408|Apis mellifera complementary sex det... 25 0.85 AY569709-1|AAS86662.1| 408|Apis mellifera complementary sex det... 24 2.0 AY686596-1|AAT96374.1| 1946|Apis mellifera Dscam protein. 23 2.6 DQ011226-1|AAY63895.1| 471|Apis mellifera Rh-like protein protein. 23 3.4 DQ011228-1|AAY63897.1| 486|Apis mellifera Amt-2-like protein pr... 22 6.0 AJ276511-1|CAC06383.1| 352|Apis mellifera Antennapedia protein ... 22 6.0 AY268031-1|AAP23056.1| 810|Apis mellifera dorsal protein splice... 22 7.9 AY268030-1|AAP23055.1| 602|Apis mellifera dorsal protein protein. 22 7.9 >AB244761-1|BAE66603.1| 504|Apis mellifera cystathionine beta-synthase protein. Length = 504 Score = 27.9 bits (59), Expect = 0.12 Identities = 13/39 (33%), Positives = 24/39 (61%) Frame = -3 Query: 345 SLLRGDTVDCESALNIID*TKQFISLLN*DNIHKSSRIS 229 SLL+ +TV C+ A++++ + +++ DNIH IS Sbjct: 381 SLLKENTVTCQEAMHMLKNADSQLLVISDDNIHIKGVIS 419 >AY569707-1|AAS86660.1| 408|Apis mellifera complementary sex determiner protein. Length = 408 Score = 25.0 bits (52), Expect = 0.85 Identities = 10/21 (47%), Positives = 13/21 (61%) Frame = +2 Query: 584 RDIPAPSTLCTSRTPRDTPSP 646 RD+P ST T+ RDT +P Sbjct: 137 RDLPGKSTTTTAEVKRDTINP 157 >AY569709-1|AAS86662.1| 408|Apis mellifera complementary sex determiner protein. Length = 408 Score = 23.8 bits (49), Expect = 2.0 Identities = 10/21 (47%), Positives = 12/21 (57%) Frame = +2 Query: 584 RDIPAPSTLCTSRTPRDTPSP 646 RD+P ST T RDT +P Sbjct: 137 RDLPGKSTTTTVEVKRDTINP 157 >AY686596-1|AAT96374.1| 1946|Apis mellifera Dscam protein. Length = 1946 Score = 23.4 bits (48), Expect = 2.6 Identities = 11/44 (25%), Positives = 16/44 (36%) Frame = +3 Query: 615 HQGLHGTHLRHEVEQRVHNRQGHEGVHFAAAREGHSPYHXRGAG 746 H G G + H H+R G + + R P G+G Sbjct: 1755 HSGTMGPPVGHPTNASAHSRSGSQSMPRQNGRYSRVPSQGGGSG 1798 Score = 22.2 bits (45), Expect = 6.0 Identities = 11/34 (32%), Positives = 16/34 (47%) Frame = +1 Query: 139 RLKYALTGNEVLKIVKQRLIKVDGKVRTDPTYPA 240 R K+ LTG L K RL+ + P +P+ Sbjct: 182 RTKHRLTGETRLSATKGRLVITEPVGSVRPKFPS 215 >DQ011226-1|AAY63895.1| 471|Apis mellifera Rh-like protein protein. Length = 471 Score = 23.0 bits (47), Expect = 3.4 Identities = 12/40 (30%), Positives = 21/40 (52%) Frame = -3 Query: 387 RSGRHTLDFTQLVLSLLRGDTVDCESALNIID*TKQFISL 268 R G+ + T L+ ++L + CE +NI K ++SL Sbjct: 75 RYGQSAVGLTFLLGAILVQVAIICEGVMNIQKDNKSYLSL 114 >DQ011228-1|AAY63897.1| 486|Apis mellifera Amt-2-like protein protein. Length = 486 Score = 22.2 bits (45), Expect = 6.0 Identities = 9/16 (56%), Positives = 10/16 (62%) Frame = -3 Query: 618 DVHNVEGAGMSLAGHD 571 DVH V GAG + HD Sbjct: 110 DVHGVIGAGHWIGDHD 125 >AJ276511-1|CAC06383.1| 352|Apis mellifera Antennapedia protein protein. Length = 352 Score = 22.2 bits (45), Expect = 6.0 Identities = 11/34 (32%), Positives = 17/34 (50%) Frame = -1 Query: 149 YFRRFLRKITRGKHSRNLWGPVDGLGAYTPPSLS 48 Y R +R T +H ++ +DG+G Y S S Sbjct: 83 YNRMDMRNATYYQHQQDHGSGMDGMGGYRSASPS 116 >AY268031-1|AAP23056.1| 810|Apis mellifera dorsal protein splice variant B protein. Length = 810 Score = 21.8 bits (44), Expect = 7.9 Identities = 11/38 (28%), Positives = 16/38 (42%) Frame = +1 Query: 595 GSFDIVHIKDSTGHTFATRLNNVFIIGKGTKAYISLPR 708 G F VH+ T F T + + + + YI L R Sbjct: 271 GDFQPVHVHKQTAIAFRTPTYRMQQVEQPVQVYIQLKR 308 >AY268030-1|AAP23055.1| 602|Apis mellifera dorsal protein protein. Length = 602 Score = 21.8 bits (44), Expect = 7.9 Identities = 11/38 (28%), Positives = 16/38 (42%) Frame = +1 Query: 595 GSFDIVHIKDSTGHTFATRLNNVFIIGKGTKAYISLPR 708 G F VH+ T F T + + + + YI L R Sbjct: 271 GDFQPVHVHKQTAIAFRTPTYRMQQVEQPVQVYIQLKR 308 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 234,821 Number of Sequences: 438 Number of extensions: 5416 Number of successful extensions: 20 Number of sequences better than 10.0: 9 Number of HSP's better than 10.0 without gapping: 18 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 20 length of database: 146,343 effective HSP length: 57 effective length of database: 121,377 effective search space used: 26338809 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -