BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= brP-0331 (730 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPCC1235.08c |pdh1||DUF1751 family protein|Schizosaccharomyces p... 26 6.3 SPBC21D10.05c |ucp3|soc2|GTPase activating protein Ucp3 |Schizos... 26 6.3 SPAC23A1.04c |mnl1||alpha mannosidase-like protein|Schizosacchar... 26 6.3 >SPCC1235.08c |pdh1||DUF1751 family protein|Schizosaccharomyces pombe|chr 3|||Manual Length = 226 Score = 25.8 bits (54), Expect = 6.3 Identities = 15/56 (26%), Positives = 27/56 (48%), Gaps = 3/56 (5%) Frame = +1 Query: 442 LCVICKYFIYLFIYI---YACNTFDRS*FLSFIRFLTLSRAFVATILNLTADIIYL 600 LC + KY IYLF+ I Y +F + F + +S +V + + ++ +L Sbjct: 163 LCPLSKYLIYLFLSIHLFYVFQSFPWTYFCLAVSGTCISELYVLFVHPVVQELFHL 218 >SPBC21D10.05c |ucp3|soc2|GTPase activating protein Ucp3 |Schizosaccharomyces pombe|chr 2|||Manual Length = 601 Score = 25.8 bits (54), Expect = 6.3 Identities = 13/43 (30%), Positives = 20/43 (46%) Frame = -2 Query: 405 YGNLVTTFTSSK*SSLVNFPTTPTAVKPPRVGPKTSLNHSIGS 277 YG +T+S SS+V P P P + + N+S+ S Sbjct: 321 YGIDSNLYTNSNSSSIVQNPLQPARTGPAAINYNYTTNYSVSS 363 >SPAC23A1.04c |mnl1||alpha mannosidase-like protein|Schizosaccharomyces pombe|chr 1|||Manual Length = 787 Score = 25.8 bits (54), Expect = 6.3 Identities = 11/28 (39%), Positives = 18/28 (64%) Frame = -1 Query: 430 LMILPQVPLRKPCYDFYFL*MIKFGQLP 347 L++ ++ L K + +YF +KFGQLP Sbjct: 337 LVLAGELELAKKMHLYYFSIYLKFGQLP 364 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,659,414 Number of Sequences: 5004 Number of extensions: 54365 Number of successful extensions: 141 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 122 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 141 length of database: 2,362,478 effective HSP length: 71 effective length of database: 2,007,194 effective search space used: 343230174 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -