BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= brP-0331 (730 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Z77657-7|CAH60768.1| 320|Caenorhabditis elegans Hypothetical pr... 30 1.5 Z78537-1|CAB01719.1| 182|Caenorhabditis elegans Hypothetical pr... 29 3.4 AL132851-1|CAB60411.1| 403|Caenorhabditis elegans Hypothetical ... 29 3.4 Z98877-14|CAD56615.1| 338|Caenorhabditis elegans Hypothetical p... 28 7.9 U28737-8|ABA61869.1| 537|Caenorhabditis elegans Hypothetical pr... 28 7.9 U28737-7|ABA61870.1| 501|Caenorhabditis elegans Hypothetical pr... 28 7.9 >Z77657-7|CAH60768.1| 320|Caenorhabditis elegans Hypothetical protein F08H9.12 protein. Length = 320 Score = 30.3 bits (65), Expect = 1.5 Identities = 16/65 (24%), Positives = 31/65 (47%), Gaps = 1/65 (1%) Frame = +1 Query: 448 VICKYFIYLFI-YIYACNTFDRS*FLSFIRFLTLSRAFVATILNLTADIIYLILLRTARA 624 +I K F+ LF+ Y+ + F + S + + + F+ +L L +IY+ ++ R Sbjct: 151 LISKDFLLLFLCYLNSIQYFSENNLQSLLSYYMILLLFLNIVLPLLTPLIYIPVMIVTRK 210 Query: 625 RQHTH 639 H H Sbjct: 211 NSHQH 215 >Z78537-1|CAB01719.1| 182|Caenorhabditis elegans Hypothetical protein C09F12.1 protein. Length = 182 Score = 29.1 bits (62), Expect = 3.4 Identities = 18/59 (30%), Positives = 28/59 (47%) Frame = +1 Query: 421 GSLTCVVLCVICKYFIYLFIYIYACNTFDRS*FLSFIRFLTLSRAFVATILNLTADIIY 597 G + CVV+C+I + +F +Y T +I A ++TIL L A I+Y Sbjct: 75 GWMKCVVVCMILSLIVQIFAVVYNFLTCLACCCKKYIIHPLTLFAVISTILLLIAVIVY 133 >AL132851-1|CAB60411.1| 403|Caenorhabditis elegans Hypothetical protein Y53H1B.1 protein. Length = 403 Score = 29.1 bits (62), Expect = 3.4 Identities = 17/62 (27%), Positives = 26/62 (41%) Frame = -2 Query: 456 TYHTQHNTR**SFRRFPYGNLVTTFTSSK*SSLVNFPTTPTAVKPPRVGPKTSLNHSIGS 277 TY+ +N F + + V+T+ S+ +N PPR GP S S S Sbjct: 230 TYNKDNNVAYAQVNTFKFADKVSTYFQCAVSTCMNTEGMCDGKTPPRCGPAGSFRSSSSS 289 Query: 276 SD 271 +D Sbjct: 290 ND 291 >Z98877-14|CAD56615.1| 338|Caenorhabditis elegans Hypothetical protein Y69H2.14 protein. Length = 338 Score = 27.9 bits (59), Expect = 7.9 Identities = 16/38 (42%), Positives = 23/38 (60%), Gaps = 6/38 (15%) Frame = -1 Query: 190 DNCKPQSPARRSFSGLPGPLGQ----GE--HADSFSVA 95 ++C+ +PAR+ G PGP GQ GE H+D+ S A Sbjct: 190 NDCQTCAPARQGAPGPPGPAGQPGQPGEPGHSDTSSTA 227 >U28737-8|ABA61869.1| 537|Caenorhabditis elegans Hypothetical protein F14B8.5a protein. Length = 537 Score = 27.9 bits (59), Expect = 7.9 Identities = 13/29 (44%), Positives = 17/29 (58%) Frame = -2 Query: 687 CNFGVSNGIL*CAYSFMRVLPCACSTQQY 601 CNF SN C +SF+ V+ CA + QY Sbjct: 173 CNFVPSNHQNQCQFSFVLVISCADQSIQY 201 >U28737-7|ABA61870.1| 501|Caenorhabditis elegans Hypothetical protein F14B8.5b protein. Length = 501 Score = 27.9 bits (59), Expect = 7.9 Identities = 13/29 (44%), Positives = 17/29 (58%) Frame = -2 Query: 687 CNFGVSNGIL*CAYSFMRVLPCACSTQQY 601 CNF SN C +SF+ V+ CA + QY Sbjct: 137 CNFVPSNHQNQCQFSFVLVISCADQSIQY 165 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 15,102,621 Number of Sequences: 27780 Number of extensions: 321925 Number of successful extensions: 941 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 840 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 939 length of database: 12,740,198 effective HSP length: 79 effective length of database: 10,545,578 effective search space used: 1718929214 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -