BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= brP-0331 (730 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At4g38360.2 68417.m05424 expressed protein contains Pfam profile... 31 0.78 At4g10210.1 68417.m01674 hypothetical protein IB1C3-1 protein, A... 28 5.5 At3g13784.1 68416.m01741 beta-fructosidase, putative / beta-fruc... 28 7.3 At3g10780.1 68416.m01298 emp24/gp25L/p24 family protein similar ... 27 9.6 >At4g38360.2 68417.m05424 expressed protein contains Pfam profile PF03619: Domain of unknown function Length = 485 Score = 31.1 bits (67), Expect = 0.78 Identities = 15/43 (34%), Positives = 20/43 (46%) Frame = -1 Query: 190 DNCKPQSPARRSFSGLPGPLGQGEHADSFSVARVRPRTSKGIT 62 D+C SP+RR G+ PL G +DS + R G T Sbjct: 415 DSCMSSSPSRRVIRGIDDPLLNGSFSDSGVTRTKKHRRKSGYT 457 >At4g10210.1 68417.m01674 hypothetical protein IB1C3-1 protein, Arabidopsis thaliana, AJ011845 contains Pfam profile PF03080: Arabidopsis proteins of unknown function Length = 375 Score = 28.3 bits (60), Expect = 5.5 Identities = 16/52 (30%), Positives = 23/52 (44%) Frame = -1 Query: 220 ALTRNSSFMGDNCKPQSPARRSFSGLPGPLGQGEHADSFSVARVRPRTSKGI 65 AL + SF GDN PQS +++ P G H + +PR G+ Sbjct: 141 ALLKMKSFDGDNSNPQSSWSKTYK--PTSSNGGHHFAVVRTTKGKPRRYNGV 190 >At3g13784.1 68416.m01741 beta-fructosidase, putative / beta-fructofuranosidase, putative / cell wall invertase, putative similar to beta-fructofuranosidase GI:402740 from [Arabidopsis thaliana] Length = 569 Score = 27.9 bits (59), Expect = 7.3 Identities = 15/52 (28%), Positives = 26/52 (50%), Gaps = 2/52 (3%) Frame = +2 Query: 59 VCDALRCPGPHARYTEGISMFSL--A*RPGQPAETPSCWGLGFAIIPHKRGI 208 V D + HA T+ I+ +L A RP +P++ CW I+P+ + + Sbjct: 77 VMDVNKTVWGHATSTDLINWITLSPAIRPSRPSDINGCWSGSVTILPNGKPV 128 >At3g10780.1 68416.m01298 emp24/gp25L/p24 family protein similar to SP|O35587 Transmembrane protein Tmp21 precursor (21 kDa Transmembrane trafficking protein) {Mesocricetus auratus}; contains Pfam profile: PF01105 emp24/gp25L/p24 family; contains non-consensus TG acceptor splice site at exon 3 Length = 217 Score = 27.5 bits (58), Expect = 9.6 Identities = 16/40 (40%), Positives = 21/40 (52%) Frame = -3 Query: 614 VRSSIRYIMSAVRFNIVATNARESVRNRINDKN*ERSNVL 495 +R S Y SA+R NI+ RE+ IN+K R N L Sbjct: 150 IRRSTEYA-SAIRANILYLRIREAYMREINEKTNTRVNQL 188 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 13,974,508 Number of Sequences: 28952 Number of extensions: 286897 Number of successful extensions: 689 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 650 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 688 length of database: 12,070,560 effective HSP length: 79 effective length of database: 9,783,352 effective search space used: 1594686376 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -