BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= brP-0330 (750 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At3g47680.1 68416.m05192 expressed protein contains similarity t... 31 1.1 At2g26430.1 68415.m03171 ania-6a type cyclin (RCY1) nearly ident... 31 1.1 At2g19170.1 68415.m02237 subtilase family protein contains simil... 29 3.3 At3g25840.1 68416.m03219 protein kinase family protein contains ... 29 4.4 At1g17980.2 68414.m02224 nucleotidyltransferase family protein c... 29 4.4 At1g17980.1 68414.m02225 nucleotidyltransferase family protein c... 29 4.4 At1g04580.1 68414.m00451 aldehyde oxidase, putative similar to a... 29 4.4 At5g67350.1 68418.m08493 expressed protein 28 5.8 At5g04670.1 68418.m00475 expressed protein BRL protein, Homo sap... 28 5.8 At2g44920.1 68415.m05591 thylakoid lumenal 15 kDa protein, chlor... 28 5.8 >At3g47680.1 68416.m05192 expressed protein contains similarity to hypothetical proteins of [Arabidopsis thaliana] Length = 302 Score = 30.7 bits (66), Expect = 1.1 Identities = 14/36 (38%), Positives = 19/36 (52%) Frame = +1 Query: 34 AWREEFFTPSWFSKSATTAAVSLDRHRRDVASSAKP 141 AWR F W S +T A V R + D AS+++P Sbjct: 159 AWRVLRFEQKWLSAPSTKATVMSKRRKSDKASTSQP 194 >At2g26430.1 68415.m03171 ania-6a type cyclin (RCY1) nearly identical to ania-6a type cyclin [Arabidopsis thaliana] GI:13924511 Length = 416 Score = 30.7 bits (66), Expect = 1.1 Identities = 14/37 (37%), Positives = 20/37 (54%), Gaps = 2/37 (5%) Frame = +3 Query: 243 RQRIRDSDSTSGRERLRHPQGHSD--REHAQSQRTYR 347 R +++D R+RL+ GHSD R H+ R YR Sbjct: 370 RDKLKDRSHHRSRDRLKDSGGHSDKSRHHSSRDRDYR 406 >At2g19170.1 68415.m02237 subtilase family protein contains similarity to meiotic serine proteinase TMP GI:6468325 from [Lycopersicon esculentum] Length = 815 Score = 29.1 bits (62), Expect = 3.3 Identities = 14/48 (29%), Positives = 22/48 (45%) Frame = +1 Query: 292 GILKVTPTENTHKVSEPIDPDPDYDMRDISNFTPDKIKAEHNITDLTI 435 G L TP + H++ + +YDM+ SNF I H + T+ Sbjct: 686 GFLCTTPGISAHEIRNYTNTACNYDMKHPSNFNAPSIAVSHLVGTQTV 733 >At3g25840.1 68416.m03219 protein kinase family protein contains Pfam profile: PF00069 eukaryotic protein kinase domain Length = 935 Score = 28.7 bits (61), Expect = 4.4 Identities = 14/39 (35%), Positives = 21/39 (53%) Frame = +3 Query: 231 SSGGRQRIRDSDSTSGRERLRHPQGHSDREHAQSQRTYR 347 S G ++R +DSD RER + + SDRE + + R Sbjct: 274 SEGSKRRDKDSDRRREREREKRREIESDRERRKEKERER 312 >At1g17980.2 68414.m02224 nucleotidyltransferase family protein contains Pfam profiles: PF01909 nucleotidyltransferase domain, PF04926 poly(A) polymerase predicted RNA binding domain Length = 586 Score = 28.7 bits (61), Expect = 4.4 Identities = 39/153 (25%), Positives = 60/153 (39%), Gaps = 14/153 (9%) Frame = +1 Query: 58 PSWFSKSATTAAVSLDRHRRDVASSAKPAIPVTTPAVLVTK------MDKIIKNDTGIAN 219 PS SK T + HR SSA A TT +K +D + Sbjct: 361 PSHTSKG-TWDSNRRSEHRNSSTSSAPAATTTTTEMSSESKAGSNSPVDGKKRKWGDSET 419 Query: 220 VTDAPRADGNVSVTQIPLLGVNGS------GILKVTPTEN--THKVSEPIDPDPDYDMRD 375 +TD PR +++V+ +P+ G G + +P ++ T+ SEPI DP ++ Sbjct: 420 LTDQPRNSKHIAVS-VPVENCEGGSPNPSVGSICSSPMKDYCTNGKSEPISKDPPENVVA 478 Query: 376 ISNFTPDKIKAEHNITDLTIDNHEFYNSSFIGN 474 S P+ + E T + E S GN Sbjct: 479 FSKDPPESLPIEKIATPQAHETEELEESFDFGN 511 >At1g17980.1 68414.m02225 nucleotidyltransferase family protein contains Pfam profiles: PF01909 nucleotidyltransferase domain, PF04926 poly(A) polymerase predicted RNA binding domain Length = 713 Score = 28.7 bits (61), Expect = 4.4 Identities = 39/153 (25%), Positives = 60/153 (39%), Gaps = 14/153 (9%) Frame = +1 Query: 58 PSWFSKSATTAAVSLDRHRRDVASSAKPAIPVTTPAVLVTK------MDKIIKNDTGIAN 219 PS SK T + HR SSA A TT +K +D + Sbjct: 488 PSHTSKG-TWDSNRRSEHRNSSTSSAPAATTTTTEMSSESKAGSNSPVDGKKRKWGDSET 546 Query: 220 VTDAPRADGNVSVTQIPLLGVNGS------GILKVTPTEN--THKVSEPIDPDPDYDMRD 375 +TD PR +++V+ +P+ G G + +P ++ T+ SEPI DP ++ Sbjct: 547 LTDQPRNSKHIAVS-VPVENCEGGSPNPSVGSICSSPMKDYCTNGKSEPISKDPPENVVA 605 Query: 376 ISNFTPDKIKAEHNITDLTIDNHEFYNSSFIGN 474 S P+ + E T + E S GN Sbjct: 606 FSKDPPESLPIEKIATPQAHETEELEESFDFGN 638 >At1g04580.1 68414.m00451 aldehyde oxidase, putative similar to aldehyde oxidases from Arabidopsis thaliana: GI:3172023, GI:3172025, GI:3172044; identical to cDNA putative aldehyde oxidase (AO2) mRNA, partial cds GI:2792305 Length = 1337 Score = 28.7 bits (61), Expect = 4.4 Identities = 12/40 (30%), Positives = 24/40 (60%), Gaps = 1/40 (2%) Frame = +1 Query: 316 ENTHKVSEPIDP-DPDYDMRDISNFTPDKIKAEHNITDLT 432 E+ ++ + + P +P+ D+ +F +KIK +HN+ D T Sbjct: 189 ESREEMLKKLPPYNPEKDLITFPDFLKEKIKCQHNVLDQT 228 >At5g67350.1 68418.m08493 expressed protein Length = 302 Score = 28.3 bits (60), Expect = 5.8 Identities = 11/35 (31%), Positives = 21/35 (60%) Frame = -3 Query: 721 RSVEVSHQRSNVLRSXQPVVNVLAGVNEPSPWPRL 617 RS V +R+ ++RS + + N ++PSP P++ Sbjct: 117 RSESVEFRRTGIIRSDRKIKNNFIDYSQPSPQPQI 151 >At5g04670.1 68418.m00475 expressed protein BRL protein, Homo sapiens, EMBL:AF005067 Length = 766 Score = 28.3 bits (60), Expect = 5.8 Identities = 13/28 (46%), Positives = 18/28 (64%) Frame = -2 Query: 302 LRMPEPFTPRSGI*VTDTLPSARGASVT 219 L +PEP TPR+G+ V PS R + +T Sbjct: 287 LALPEPCTPRNGV-VVGLHPSVRASKLT 313 >At2g44920.1 68415.m05591 thylakoid lumenal 15 kDa protein, chloroplast identical to SP|O22160 Thylakoid lumenal 15 kDa protein, chloroplast precursor (p15) {Arabidopsis thaliana}; contains 8 pentapeptide repeats Length = 210 Score = 28.3 bits (60), Expect = 5.8 Identities = 15/57 (26%), Positives = 27/57 (47%) Frame = +1 Query: 415 NITDLTIDNHEFYNSSFIGNAMFFNEYWANITTKGANAHRLLSNSHRRATMIQLSFT 585 N+T + + N ++ GN F +NIT G N+++ +++ LSFT Sbjct: 157 NVTKVNLTNANLEGATVTGNTSFKG---SNITGAGEKRKENFHNNNKHISLLPLSFT 210 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 15,129,710 Number of Sequences: 28952 Number of extensions: 312668 Number of successful extensions: 921 Number of sequences better than 10.0: 10 Number of HSP's better than 10.0 without gapping: 881 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 921 length of database: 12,070,560 effective HSP length: 79 effective length of database: 9,783,352 effective search space used: 1663169840 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -