BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= brP-0321 (750 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 11_02_0151 + 8837444-8837876,8838173-8839434,8839517-8839885,883... 28 6.9 09_03_0010 - 11486996-11488073,11488704-11488838,11502017-11502429 28 6.9 07_03_1231 + 25047067-25047262,25047876-25048045,25048897-250490... 28 6.9 11_01_0489 + 3776563-3776692,3776995-3777073,3777532-3777840,377... 28 9.1 04_03_0897 - 20646750-20646918,20647927-20648038,20649650-206501... 28 9.1 01_06_1087 - 34430521-34430899,34432336-34432806,34432926-344331... 28 9.1 >11_02_0151 + 8837444-8837876,8838173-8839434,8839517-8839885, 8839963-8840223,8840230-8840442,8840602-8840967, 8841402-8841667,8842087-8842197,8842288-8842317, 8842444-8842465 Length = 1110 Score = 28.3 bits (60), Expect = 6.9 Identities = 15/37 (40%), Positives = 19/37 (51%) Frame = +2 Query: 563 KSSGQGQGHSYPFSQTGLSGEQPAKTTTQVSRNCSKK 673 + S + G + P S T SG QP TTT C+KK Sbjct: 570 RRSKRNAGRAEPESDTTTSGPQPTDTTTS-GEACAKK 605 >09_03_0010 - 11486996-11488073,11488704-11488838,11502017-11502429 Length = 541 Score = 28.3 bits (60), Expect = 6.9 Identities = 12/27 (44%), Positives = 20/27 (74%) Frame = +1 Query: 625 TASQNNHPSIKKLFKEIMLLSIRTXNK 705 TA +++ P IKK+FK+++L +T NK Sbjct: 133 TARRDSAPDIKKVFKDMLLELDKTKNK 159 >07_03_1231 + 25047067-25047262,25047876-25048045,25048897-25049030, 25049122-25049369,25049799-25049904,25049992-25050130, 25050258-25050385,25050472-25050733 Length = 460 Score = 28.3 bits (60), Expect = 6.9 Identities = 14/26 (53%), Positives = 16/26 (61%) Frame = -2 Query: 536 LPKLAHLAPSSDLRLHRSSKPEFSPI 459 L L +LAP DLR+ SSKP F I Sbjct: 259 LETLVNLAPVLDLRIFSSSKPSFIKI 284 >11_01_0489 + 3776563-3776692,3776995-3777073,3777532-3777840, 3778828-3778898,3778975-3779213,3779306-3779383, 3779734-3780156,3780416-3780661,3780886-3780978, 3781480-3781527 Length = 571 Score = 27.9 bits (59), Expect = 9.1 Identities = 11/28 (39%), Positives = 16/28 (57%) Frame = +2 Query: 275 KSIVGTGYRGERLIEPSSSWFRPKFPSG 358 + + GTG + PSS+WF P+ SG Sbjct: 12 RCVFGTGPLPPASLSPSSAWFDPELSSG 39 >04_03_0897 - 20646750-20646918,20647927-20648038,20649650-20650108, 20650237-20650330,20650449-20650525,20650637-20650688, 20650770-20650927,20651191-20651281,20651465-20652529 Length = 758 Score = 27.9 bits (59), Expect = 9.1 Identities = 12/37 (32%), Positives = 24/37 (64%) Frame = +1 Query: 202 DGELCLVRSKSGETLMEDRSDSDVQIDRRNWV*GRKT 312 DG+ +V + SGE D+S ++Q+D+ ++ G+K+ Sbjct: 436 DGKGFIVGTTSGECRFYDQSGENIQLDKELFMQGKKS 472 >01_06_1087 - 34430521-34430899,34432336-34432806,34432926-34433112, 34433470-34433599,34433794-34434125,34434566-34435050, 34435185-34435752,34436579-34436640,34437569-34437636 Length = 893 Score = 27.9 bits (59), Expect = 9.1 Identities = 20/55 (36%), Positives = 26/55 (47%), Gaps = 1/55 (1%) Frame = -1 Query: 456 KFENRLRSFRPQCL*SFALPDETVLKFYIDASYPEGNF-GRNQLLDGSISLSPLY 295 K E LRSF + LP K+ I A++ GN+ GRN GS L L+ Sbjct: 93 KQEETLRSFPDGQRNCYTLPTNRSKKYLIRATFTYGNYDGRNSSESGSPFLFGLH 147 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 19,787,516 Number of Sequences: 37544 Number of extensions: 427031 Number of successful extensions: 804 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 791 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 804 length of database: 14,793,348 effective HSP length: 80 effective length of database: 11,789,828 effective search space used: 1992480932 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -