BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= brP-0321 (750 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Z75525-2|CAA99763.1| 1390|Caenorhabditis elegans Hypothetical pr... 29 4.7 >Z75525-2|CAA99763.1| 1390|Caenorhabditis elegans Hypothetical protein C03D6.4 protein. Length = 1390 Score = 28.7 bits (61), Expect = 4.7 Identities = 22/78 (28%), Positives = 33/78 (42%), Gaps = 2/78 (2%) Frame = +2 Query: 440 NLFSNFKWVRTPAYSNDEA--GDLMTVPSGPILVSRTGAVG*TKSSGQGQGHSYPFSQTG 613 ++F +TP+ SN G T + P S T ++ G + S PF G Sbjct: 1071 SIFGGGLKTQTPSSSNSTNIFGARTTTTATPTPASNTSSI----FGGGSKAASSPFGSFG 1126 Query: 614 LSGEQPAKTTTQVSRNCS 667 +G QPAKT+ + S Sbjct: 1127 QAGCQPAKTSNPATSTAS 1144 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 16,567,270 Number of Sequences: 27780 Number of extensions: 354175 Number of successful extensions: 849 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 718 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 849 length of database: 12,740,198 effective HSP length: 80 effective length of database: 10,517,798 effective search space used: 1777507862 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -