BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= brP-0321 (750 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At3g49600.1 68416.m05421 ubiquitin-specific protease 26 (UBP26) ... 31 0.82 At1g74690.1 68414.m08650 calmodulin-binding family protein low s... 29 2.5 >At3g49600.1 68416.m05421 ubiquitin-specific protease 26 (UBP26) similar to GI:11993492; RNA binding protein - Homo sapiens, EMBL:AB016089 (N-terminus), several ubiquitin carboxyl-terminal hydrolases from aa pos. 712 Length = 1067 Score = 31.1 bits (67), Expect = 0.82 Identities = 14/35 (40%), Positives = 19/35 (54%) Frame = +1 Query: 211 LCLVRSKSGETLMEDRSDSDVQIDRRNWV*GRKTN 315 +C VR K M + SDS ++DRR R+TN Sbjct: 928 VCFVRGKEAPKAMLEASDSSFEVDRRTSKRSRRTN 962 >At1g74690.1 68414.m08650 calmodulin-binding family protein low similarity to SF16 protein [Helianthus annuus] GI:560150; contains Pfam profile PF00612: IQ calmodulin-binding motif Length = 587 Score = 29.5 bits (63), Expect = 2.5 Identities = 15/32 (46%), Positives = 20/32 (62%) Frame = -1 Query: 522 PLGTVIRSPASSFE*AGVLTHLKFENRLRSFR 427 P +V + PAS+FE + V T +FE RSFR Sbjct: 282 PKKSVRKVPASNFESSSVQTSFEFEKPKRSFR 313 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 15,838,954 Number of Sequences: 28952 Number of extensions: 336579 Number of successful extensions: 690 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 680 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 690 length of database: 12,070,560 effective HSP length: 79 effective length of database: 9,783,352 effective search space used: 1663169840 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -