BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= brP-0316 (750 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AB244761-1|BAE66603.1| 504|Apis mellifera cystathionine beta-sy... 28 0.11 AY569707-1|AAS86660.1| 408|Apis mellifera complementary sex det... 25 0.76 AY569709-1|AAS86662.1| 408|Apis mellifera complementary sex det... 24 1.8 DQ011226-1|AAY63895.1| 471|Apis mellifera Rh-like protein protein. 23 3.1 DQ011228-1|AAY63897.1| 486|Apis mellifera Amt-2-like protein pr... 22 5.3 AY686596-1|AAT96374.1| 1946|Apis mellifera Dscam protein. 22 5.3 AJ276511-1|CAC06383.1| 352|Apis mellifera Antennapedia protein ... 22 5.3 AY268031-1|AAP23056.1| 810|Apis mellifera dorsal protein splice... 22 7.1 AY268030-1|AAP23055.1| 602|Apis mellifera dorsal protein protein. 22 7.1 AY500239-1|AAR92109.1| 555|Apis mellifera neuronal nicotinic ac... 21 9.3 AB253416-1|BAE86927.1| 580|Apis mellifera alpha-glucosidase pro... 21 9.3 >AB244761-1|BAE66603.1| 504|Apis mellifera cystathionine beta-synthase protein. Length = 504 Score = 27.9 bits (59), Expect = 0.11 Identities = 13/39 (33%), Positives = 24/39 (61%) Frame = -2 Query: 335 SLLRGDTVDCESALNIID*TKQFISLLN*DNIHKSSRIS 219 SLL+ +TV C+ A++++ + +++ DNIH IS Sbjct: 381 SLLKENTVTCQEAMHMLKNADSQLLVISDDNIHIKGVIS 419 >AY569707-1|AAS86660.1| 408|Apis mellifera complementary sex determiner protein. Length = 408 Score = 25.0 bits (52), Expect = 0.76 Identities = 10/21 (47%), Positives = 13/21 (61%) Frame = +1 Query: 574 RDIPAPSTLCTSRTPRDTPSP 636 RD+P ST T+ RDT +P Sbjct: 137 RDLPGKSTTTTAEVKRDTINP 157 >AY569709-1|AAS86662.1| 408|Apis mellifera complementary sex determiner protein. Length = 408 Score = 23.8 bits (49), Expect = 1.8 Identities = 10/21 (47%), Positives = 12/21 (57%) Frame = +1 Query: 574 RDIPAPSTLCTSRTPRDTPSP 636 RD+P ST T RDT +P Sbjct: 137 RDLPGKSTTTTVEVKRDTINP 157 >DQ011226-1|AAY63895.1| 471|Apis mellifera Rh-like protein protein. Length = 471 Score = 23.0 bits (47), Expect = 3.1 Identities = 12/40 (30%), Positives = 21/40 (52%) Frame = -2 Query: 377 RSGRHTLDFTQLVLSLLRGDTVDCESALNIID*TKQFISL 258 R G+ + T L+ ++L + CE +NI K ++SL Sbjct: 75 RYGQSAVGLTFLLGAILVQVAIICEGVMNIQKDNKSYLSL 114 >DQ011228-1|AAY63897.1| 486|Apis mellifera Amt-2-like protein protein. Length = 486 Score = 22.2 bits (45), Expect = 5.3 Identities = 9/16 (56%), Positives = 10/16 (62%) Frame = -2 Query: 608 DVHNVEGAGMSLAGHD 561 DVH V GAG + HD Sbjct: 110 DVHGVIGAGHWIGDHD 125 >AY686596-1|AAT96374.1| 1946|Apis mellifera Dscam protein. Length = 1946 Score = 22.2 bits (45), Expect = 5.3 Identities = 11/34 (32%), Positives = 16/34 (47%) Frame = +3 Query: 129 RLKYALTGNEVLKIVKQRLIKVDGKVRTDPTYPA 230 R K+ LTG L K RL+ + P +P+ Sbjct: 182 RTKHRLTGETRLSATKGRLVITEPVGSVRPKFPS 215 Score = 22.2 bits (45), Expect = 5.3 Identities = 11/45 (24%), Positives = 15/45 (33%) Frame = +2 Query: 605 HQGLHGTHLRHEVEQRVHNRQGHEGVHLAAARQGHSAXPSARSGT 739 H G G + H H+R G + + R SGT Sbjct: 1755 HSGTMGPPVGHPTNASAHSRSGSQSMPRQNGRYSRVPSQGGGSGT 1799 >AJ276511-1|CAC06383.1| 352|Apis mellifera Antennapedia protein protein. Length = 352 Score = 22.2 bits (45), Expect = 5.3 Identities = 11/34 (32%), Positives = 17/34 (50%) Frame = -3 Query: 139 YFRRFLRKITRGKHSRNLWGPVDGLGAYTPPSLS 38 Y R +R T +H ++ +DG+G Y S S Sbjct: 83 YNRMDMRNATYYQHQQDHGSGMDGMGGYRSASPS 116 >AY268031-1|AAP23056.1| 810|Apis mellifera dorsal protein splice variant B protein. Length = 810 Score = 21.8 bits (44), Expect = 7.1 Identities = 11/38 (28%), Positives = 16/38 (42%) Frame = +3 Query: 585 GSFDIVHIKDSTGHTFATRLNNVFIIGKGTKAYISLPR 698 G F VH+ T F T + + + + YI L R Sbjct: 271 GDFQPVHVHKQTAIAFRTPTYRMQQVEQPVQVYIQLKR 308 >AY268030-1|AAP23055.1| 602|Apis mellifera dorsal protein protein. Length = 602 Score = 21.8 bits (44), Expect = 7.1 Identities = 11/38 (28%), Positives = 16/38 (42%) Frame = +3 Query: 585 GSFDIVHIKDSTGHTFATRLNNVFIIGKGTKAYISLPR 698 G F VH+ T F T + + + + YI L R Sbjct: 271 GDFQPVHVHKQTAIAFRTPTYRMQQVEQPVQVYIQLKR 308 >AY500239-1|AAR92109.1| 555|Apis mellifera neuronal nicotinic acetylcholine receptoralpha7-1 protein. Length = 555 Score = 21.4 bits (43), Expect = 9.3 Identities = 9/23 (39%), Positives = 11/23 (47%) Frame = -1 Query: 429 LGSGWCGHHALPSTEHS*VRSPH 361 +G G HA P HS +PH Sbjct: 419 MGHGHSHIHATPHHHHSHAATPH 441 >AB253416-1|BAE86927.1| 580|Apis mellifera alpha-glucosidase protein. Length = 580 Score = 21.4 bits (43), Expect = 9.3 Identities = 10/36 (27%), Positives = 20/36 (55%) Frame = +2 Query: 17 RSQTWXVGQTWRCVCTETVNRSPQVARVLAPGDFPE 124 +S+T+ V ++WR + E NR+ R++ + E Sbjct: 261 QSETYDVLRSWRNLMDEHSNRTNSDPRMILTEAYTE 296 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 226,176 Number of Sequences: 438 Number of extensions: 5349 Number of successful extensions: 17 Number of sequences better than 10.0: 11 Number of HSP's better than 10.0 without gapping: 15 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 17 length of database: 146,343 effective HSP length: 56 effective length of database: 121,815 effective search space used: 23510295 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -