BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= brP-0314 (700 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value DQ219483-1|ABB29887.1| 961|Anopheles gambiae cryptochrome 2 pro... 25 2.3 AF364132-2|AAL35509.1| 411|Anopheles gambiae putative odorant r... 24 4.0 AY353563-1|AAQ57599.1| 1132|Anopheles gambiae relish protein. 23 7.0 >DQ219483-1|ABB29887.1| 961|Anopheles gambiae cryptochrome 2 protein. Length = 961 Score = 25.0 bits (52), Expect = 2.3 Identities = 12/53 (22%), Positives = 23/53 (43%) Frame = -3 Query: 395 RYSAAKSAWLHTFLGSPLFSSVVSPCADSFSINHFSDKLYTCFCLSGSLFTSF 237 R + A + W G P ++++ + I+H + CF G L+ S+ Sbjct: 322 RNAEALAKWASGQTGFPWIDAIMTQLREEGWIHHLARHAVACFLTRGDLWISW 374 >AF364132-2|AAL35509.1| 411|Anopheles gambiae putative odorant receptor Or3 protein. Length = 411 Score = 24.2 bits (50), Expect = 4.0 Identities = 13/36 (36%), Positives = 18/36 (50%), Gaps = 1/36 (2%) Frame = -2 Query: 432 EQQLWSCINVKFPILRCKISLAPYFSWFTFV-FISC 328 E++L I++ +L C L F W FV FI C Sbjct: 258 EKELNEIISMHQRVLNCVFLLETTFRWVFFVQFIQC 293 >AY353563-1|AAQ57599.1| 1132|Anopheles gambiae relish protein. Length = 1132 Score = 23.4 bits (48), Expect = 7.0 Identities = 9/14 (64%), Positives = 9/14 (64%) Frame = +2 Query: 542 FLAPEPTYSPPEAV 583 F APEP YS P V Sbjct: 178 FAAPEPNYSEPHLV 191 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 716,627 Number of Sequences: 2352 Number of extensions: 16504 Number of successful extensions: 45 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 43 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 45 length of database: 563,979 effective HSP length: 62 effective length of database: 418,155 effective search space used: 71086350 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -