BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= brP-0314 (700 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value EF117814-1|ABO38437.1| 570|Apis mellifera cryptochrome 2 protein. 25 0.91 AF084556-1|AAC71015.1| 652|Apis mellifera pipsqueak protein. 23 3.7 AY500239-1|AAR92109.1| 555|Apis mellifera neuronal nicotinic ac... 21 8.5 >EF117814-1|ABO38437.1| 570|Apis mellifera cryptochrome 2 protein. Length = 570 Score = 24.6 bits (51), Expect = 0.91 Identities = 11/49 (22%), Positives = 22/49 (44%) Frame = -3 Query: 383 AKSAWLHTFLGSPLFSSVVSPCADSFSINHFSDKLYTCFCLSGSLFTSF 237 A + W + G P ++++ + I+H + CF G L+ S+ Sbjct: 343 ALAKWANGQTGFPWIDAIMTQLREEGWIHHLARHAVACFLTRGDLWISW 391 >AF084556-1|AAC71015.1| 652|Apis mellifera pipsqueak protein. Length = 652 Score = 22.6 bits (46), Expect = 3.7 Identities = 9/17 (52%), Positives = 13/17 (76%) Frame = +2 Query: 635 YSEEEMNNEFKDWEHQD 685 Y EEE +NE +WEH++ Sbjct: 179 YKEEE-SNENYNWEHKE 194 >AY500239-1|AAR92109.1| 555|Apis mellifera neuronal nicotinic acetylcholine receptoralpha7-1 protein. Length = 555 Score = 21.4 bits (43), Expect = 8.5 Identities = 13/41 (31%), Positives = 17/41 (41%) Frame = -1 Query: 190 HNDH*SPCGGHSCLSYCKQQPLWTRPCPFPPR*PGSQLENL 68 H+ H +P HS Q P PP PG Q+E + Sbjct: 441 HHQHSTPLA-HSSYPAAIQIGHTPHHHPHPPETPGPQVETI 480 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 193,734 Number of Sequences: 438 Number of extensions: 4220 Number of successful extensions: 7 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 6 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 7 length of database: 146,343 effective HSP length: 56 effective length of database: 121,815 effective search space used: 21439440 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -