BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= brP-0312 (750 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_13936| Best HMM Match : ABC_tran (HMM E-Value=4.6e-14) 172 3e-43 SB_27093| Best HMM Match : No HMM Matches (HMM E-Value=.) 80 2e-15 SB_30085| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_40345| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 2e-04 SB_16851| Best HMM Match : ABC_tran (HMM E-Value=6.1e-05) 41 0.001 SB_42212| Best HMM Match : ABC_tran (HMM E-Value=0) 39 0.005 SB_34187| Best HMM Match : ABC_tran (HMM E-Value=1.49995e-41) 38 0.009 SB_59051| Best HMM Match : ABC_tran (HMM E-Value=2.4e-41) 38 0.009 SB_28063| Best HMM Match : ABC_tran (HMM E-Value=0) 37 0.015 SB_17925| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.020 SB_33973| Best HMM Match : ABC_tran (HMM E-Value=0) 37 0.020 SB_1653| Best HMM Match : ABC_tran (HMM E-Value=0) 36 0.027 SB_216| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.027 SB_33165| Best HMM Match : ABC_tran (HMM E-Value=0) 35 0.061 SB_40695| Best HMM Match : ABC_tran (HMM E-Value=7.79963e-42) 35 0.081 SB_59357| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.14 SB_53871| Best HMM Match : ABC_tran (HMM E-Value=1.49939e-42) 34 0.14 SB_11108| Best HMM Match : ABC_tran (HMM E-Value=0) 34 0.14 SB_8906| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.14 SB_32252| Best HMM Match : RVT_1 (HMM E-Value=9.2e-21) 33 0.19 SB_36385| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.19 SB_35301| Best HMM Match : ABC_tran (HMM E-Value=0) 33 0.25 SB_45078| Best HMM Match : ABC_tran (HMM E-Value=2.6e-36) 33 0.33 SB_22546| Best HMM Match : ABC_tran (HMM E-Value=0) 33 0.33 SB_49365| Best HMM Match : ABC_tran (HMM E-Value=3.5e-38) 32 0.57 SB_40653| Best HMM Match : ABC_tran (HMM E-Value=0) 32 0.57 SB_46433| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.57 SB_52656| Best HMM Match : ABC_tran (HMM E-Value=0) 31 1.3 SB_36388| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.3 SB_16163| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 2.3 SB_38475| Best HMM Match : ASC (HMM E-Value=3.1e-14) 30 2.3 SB_46345| Best HMM Match : AAA_5 (HMM E-Value=0.053) 29 3.0 SB_30376| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.0 SB_29576| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.0 SB_52472| Best HMM Match : ABC_tran (HMM E-Value=4.62428e-44) 29 4.0 SB_26965| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.0 SB_20094| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.0 SB_40840| Best HMM Match : ABC-3 (HMM E-Value=2.4) 29 5.3 SB_52342| Best HMM Match : ABC_tran (HMM E-Value=5.29999e-41) 28 7.0 SB_34083| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 7.0 SB_30636| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 7.0 SB_26398| Best HMM Match : Protamine_P2 (HMM E-Value=4) 28 7.0 SB_20258| Best HMM Match : Exo_endo_phos (HMM E-Value=7.1e-16) 28 7.0 SB_35286| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 7.0 SB_14872| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 7.0 SB_10268| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 7.0 SB_39061| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 9.3 SB_48818| Best HMM Match : Exo_endo_phos (HMM E-Value=0.00029) 28 9.3 SB_48424| Best HMM Match : PSI (HMM E-Value=0.4) 28 9.3 SB_42532| Best HMM Match : Exo_endo_phos (HMM E-Value=7.2e-16) 28 9.3 SB_7365| Best HMM Match : ABC_membrane (HMM E-Value=0) 28 9.3 SB_4370| Best HMM Match : PSI (HMM E-Value=0.4) 28 9.3 >SB_13936| Best HMM Match : ABC_tran (HMM E-Value=4.6e-14) Length = 441 Score = 172 bits (418), Expect = 3e-43 Identities = 78/116 (67%), Positives = 96/116 (82%) Frame = +2 Query: 233 ARSCTGSLAVHPRSRDIKIANFSITFYGSELLQDTLLELNCGRRYGLVGLNGCGKSSLLA 412 +R+CTG L HP S+D+KI NFSITF+G ELL D LELN GR+YGL+GLNGCGKS++L Sbjct: 40 SRACTGVLGSHPMSKDVKIDNFSITFHGVELLTDAKLELNTGRKYGLIGLNGCGKSTMLT 99 Query: 413 ALGRREVPIPEHIDIFHLTREMPASDKTALQCVMEVDEERVKLEKLAEMLAHCEDD 580 A+G+RE+PIPEH DIFHLT E+ ASDKTALQCVMEVD+ER +LE+ AE L+ D+ Sbjct: 100 AIGKREIPIPEHFDIFHLTSEIEASDKTALQCVMEVDKERHRLEEEAEELSKMGDE 155 >SB_27093| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 683 Score = 80.2 bits (189), Expect = 2e-15 Identities = 41/108 (37%), Positives = 64/108 (59%) Frame = +2 Query: 269 RSRDIKIANFSITFYGSELLQDTLLELNCGRRYGLVGLNGCGKSSLLAALGRREVPIPEH 448 +S+DI+I NF + + LL+ L + GRRYGLVG NG GK++LL L +RE+ + + Sbjct: 203 KSQDIRIENFDLAYGNRSLLKGANLAIAFGRRYGLVGRNGIGKTTLLRTLSKRELFVASN 262 Query: 449 IDIFHLTREMPASDKTALQCVMEVDEERVKLEKLAEMLAHCEDDESQE 592 I I ++ +E+ + AL+ V+E D ER L K + LA +S + Sbjct: 263 ISILYVEQEVVGDETPALESVLECDTERFNLLKEEKALAASTSSKSPD 310 >SB_30085| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 472 Score = 44.0 bits (99), Expect = 1e-04 Identities = 24/62 (38%), Positives = 37/62 (59%), Gaps = 2/62 (3%) Frame = +2 Query: 266 PRSRDIKIANFSITFY--GSELLQDTLLELNCGRRYGLVGLNGCGKSSLLAALGRREVPI 439 P ++K N S+ +Y G ++L + +++ G R G+ G G GKSSL+AAL R +P Sbjct: 227 PAHGNVKFENVSLRYYEGGPQVLHNLNIDIKGGERVGVAGRTGAGKSSLVAALFR--MPD 284 Query: 440 PE 445 PE Sbjct: 285 PE 286 >SB_40345| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1250 Score = 43.6 bits (98), Expect = 2e-04 Identities = 23/62 (37%), Positives = 35/62 (56%), Gaps = 2/62 (3%) Frame = +2 Query: 266 PRSRDIKIANFSITFY--GSELLQDTLLELNCGRRYGLVGLNGCGKSSLLAALGRREVPI 439 P+ + + N S+ +Y E+L+D +N R G+ G G GKSSL++AL R +P Sbjct: 1005 PKKGAVDLVNVSLAYYPGAPEVLKDVTFSINPAERVGIAGRTGAGKSSLVSALFR--MPD 1062 Query: 440 PE 445 PE Sbjct: 1063 PE 1064 >SB_16851| Best HMM Match : ABC_tran (HMM E-Value=6.1e-05) Length = 113 Score = 41.1 bits (92), Expect = 0.001 Identities = 18/30 (60%), Positives = 24/30 (80%) Frame = +2 Query: 593 QLMDVYDRLDDLSADTAEARAANILHGLGF 682 +L +V++RL++L A AE RAA ILHGLGF Sbjct: 28 KLTEVFERLEELDAAHAEVRAAEILHGLGF 57 >SB_42212| Best HMM Match : ABC_tran (HMM E-Value=0) Length = 301 Score = 38.7 bits (86), Expect = 0.005 Identities = 22/64 (34%), Positives = 36/64 (56%), Gaps = 2/64 (3%) Frame = +2 Query: 266 PRSRDIKIANFSITFY--GSELLQDTLLELNCGRRYGLVGLNGCGKSSLLAALGRREVPI 439 P ++++ + S+ +Y GS L++ + + + G+VG G GKSSL+AAL R P Sbjct: 56 PDRGELRLQDVSLAYYEGGSCALEEVNVRIQAKGKVGIVGRTGAGKSSLVAALFRMPEPK 115 Query: 440 PEHI 451 E I Sbjct: 116 GEVI 119 >SB_34187| Best HMM Match : ABC_tran (HMM E-Value=1.49995e-41) Length = 1515 Score = 37.9 bits (84), Expect = 0.009 Identities = 19/41 (46%), Positives = 25/41 (60%) Frame = +2 Query: 323 LLQDTLLELNCGRRYGLVGLNGCGKSSLLAALGRREVPIPE 445 +L+D L++ G R G+VG G GKSS+ AAL R P E Sbjct: 1351 VLRDITLDVRPGERVGIVGKTGAGKSSVFAALFRMPDPTGE 1391 >SB_59051| Best HMM Match : ABC_tran (HMM E-Value=2.4e-41) Length = 474 Score = 37.9 bits (84), Expect = 0.009 Identities = 20/55 (36%), Positives = 31/55 (56%), Gaps = 2/55 (3%) Frame = +2 Query: 266 PRSRDIKIANFSITFY--GSELLQDTLLELNCGRRYGLVGLNGCGKSSLLAALGR 424 P + + N S+T+ G L+D ++ G + G+VG NG GKSS++ AL R Sbjct: 61 PSAGHVVCDNVSLTYEKDGLRALKDLTFSVSAGEKIGIVGRNGSGKSSVIHALFR 115 >SB_28063| Best HMM Match : ABC_tran (HMM E-Value=0) Length = 1238 Score = 37.1 bits (82), Expect = 0.015 Identities = 19/54 (35%), Positives = 32/54 (59%), Gaps = 2/54 (3%) Frame = +2 Query: 281 IKIANFSITFY--GSELLQDTLLELNCGRRYGLVGLNGCGKSSLLAALGRREVP 436 + + + S+ ++ G+ +L+ LE+ + G+VG G GKSSL+AAL R P Sbjct: 995 LSVQDMSLVYHEGGARVLEGISLEVQPKEKVGIVGRTGAGKSSLVAALFRMPEP 1048 Score = 29.9 bits (64), Expect = 2.3 Identities = 16/38 (42%), Positives = 22/38 (57%) Frame = +2 Query: 326 LQDTLLELNCGRRYGLVGLNGCGKSSLLAALGRREVPI 439 L D L + + + G GCGK+SLL A+ RE+PI Sbjct: 417 LSDVSLSAHSSQLVMVTGAVGCGKTSLLMAI-LREIPI 453 >SB_17925| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1075 Score = 36.7 bits (81), Expect = 0.020 Identities = 18/37 (48%), Positives = 22/37 (59%) Frame = +2 Query: 326 LQDTLLELNCGRRYGLVGLNGCGKSSLLAALGRREVP 436 L D LE+ ++ G+ G G GKSSLLAAL R P Sbjct: 850 LDDITLEITAKQKVGIAGRTGAGKSSLLAALFRMPEP 886 >SB_33973| Best HMM Match : ABC_tran (HMM E-Value=0) Length = 1184 Score = 36.7 bits (81), Expect = 0.020 Identities = 19/55 (34%), Positives = 30/55 (54%), Gaps = 2/55 (3%) Frame = +2 Query: 266 PRSRDIKIANFSITFY--GSELLQDTLLELNCGRRYGLVGLNGCGKSSLLAALGR 424 P S + + N + +Y G E+L+ + + G++G G GKSSL+AAL R Sbjct: 966 PNSGQVTLDNIKLRYYEGGPEILKGVTCKFEGRKNTGIMGRTGSGKSSLVAALMR 1020 >SB_1653| Best HMM Match : ABC_tran (HMM E-Value=0) Length = 1702 Score = 36.3 bits (80), Expect = 0.027 Identities = 17/55 (30%), Positives = 32/55 (58%), Gaps = 2/55 (3%) Frame = +2 Query: 266 PRSRDIKIANFSITFY--GSELLQDTLLELNCGRRYGLVGLNGCGKSSLLAALGR 424 P + ++ S+ +Y G +L+D + +++G+VG G GKSS++A+L R Sbjct: 1461 PHDGALTFSHVSLQYYSGGPRVLKDVSFSIEPRQKFGIVGRTGAGKSSIVASLMR 1515 >SB_216| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1315 Score = 36.3 bits (80), Expect = 0.027 Identities = 18/41 (43%), Positives = 26/41 (63%) Frame = +2 Query: 314 GSELLQDTLLELNCGRRYGLVGLNGCGKSSLLAALGRREVP 436 G+ +L+ LE++ + G+VG G GKSSL+AAL R P Sbjct: 1088 GTRVLEGVNLEVDPKEKIGIVGRTGAGKSSLVAALFRMPEP 1128 >SB_33165| Best HMM Match : ABC_tran (HMM E-Value=0) Length = 1310 Score = 35.1 bits (77), Expect = 0.061 Identities = 18/37 (48%), Positives = 21/37 (56%) Frame = +2 Query: 326 LQDTLLELNCGRRYGLVGLNGCGKSSLLAALGRREVP 436 L D LE+ +R G+ G G GKS LLAAL R P Sbjct: 1085 LDDITLEITAKQRVGIAGRTGAGKSFLLAALFRLPEP 1121 >SB_40695| Best HMM Match : ABC_tran (HMM E-Value=7.79963e-42) Length = 355 Score = 34.7 bits (76), Expect = 0.081 Identities = 18/61 (29%), Positives = 32/61 (52%), Gaps = 2/61 (3%) Frame = +2 Query: 266 PRSRDIKIANFSITFY--GSELLQDTLLELNCGRRYGLVGLNGCGKSSLLAALGRREVPI 439 PR + + S+ +Y G ++L+D + ++ G+ G G GKSS++A+L R Sbjct: 114 PRHGALLFNHVSLRYYKDGPQVLKDVTFSIEPQQKIGIAGRTGAGKSSIVASLMRMPEAT 173 Query: 440 P 442 P Sbjct: 174 P 174 >SB_59357| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1716 Score = 33.9 bits (74), Expect = 0.14 Identities = 16/41 (39%), Positives = 25/41 (60%) Frame = +2 Query: 314 GSELLQDTLLELNCGRRYGLVGLNGCGKSSLLAALGRREVP 436 G E+L+ + + G++ G+VG G GKSSL+ A+ R P Sbjct: 1184 GHEVLKRISVHIKDGQKVGVVGRTGAGKSSLVRAIYRMPEP 1224 >SB_53871| Best HMM Match : ABC_tran (HMM E-Value=1.49939e-42) Length = 347 Score = 33.9 bits (74), Expect = 0.14 Identities = 20/66 (30%), Positives = 34/66 (51%), Gaps = 3/66 (4%) Frame = +2 Query: 266 PRSRDIKIANFSITFY--GSELLQDTLLELNCGRRYGLVGLNGCGKSSLLAALGRR-EVP 436 PR + + S+ +Y G ++L+ + ++ G+ G G GKSS++A+L R E Sbjct: 106 PRHGAVSFSYVSLRYYSDGPQVLKGVTFSIEPQQKIGIAGRTGAGKSSIVASLMRMPEAS 165 Query: 437 IPEHID 454 HID Sbjct: 166 SGIHID 171 >SB_11108| Best HMM Match : ABC_tran (HMM E-Value=0) Length = 1266 Score = 33.9 bits (74), Expect = 0.14 Identities = 18/41 (43%), Positives = 24/41 (58%) Frame = +2 Query: 314 GSELLQDTLLELNCGRRYGLVGLNGCGKSSLLAALGRREVP 436 G+ +L LE+ + G+VG G GKSSL+AAL R P Sbjct: 1038 GTRVLDGVSLEVLPKEKVGIVGRTGAGKSSLVAALFRIREP 1078 Score = 27.9 bits (59), Expect = 9.3 Identities = 16/42 (38%), Positives = 24/42 (57%) Frame = +2 Query: 314 GSELLQDTLLELNCGRRYGLVGLNGCGKSSLLAALGRREVPI 439 GS L++ L + + G GCGK+SLL A+ +E+PI Sbjct: 443 GSLALRNVSLSATHDKLVMVTGSVGCGKTSLLMAI-LKEIPI 483 >SB_8906| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1116 Score = 33.9 bits (74), Expect = 0.14 Identities = 20/66 (30%), Positives = 34/66 (51%), Gaps = 3/66 (4%) Frame = +2 Query: 266 PRSRDIKIANFSITFY--GSELLQDTLLELNCGRRYGLVGLNGCGKSSLLAALGRR-EVP 436 PR + + S+ +Y G ++L+ + ++ G+ G G GKSS++A+L R E Sbjct: 900 PRHGAVSFSYVSLRYYSDGPQVLKGVTFSIEPQQKIGIAGRTGAGKSSIVASLMRMPEAS 959 Query: 437 IPEHID 454 HID Sbjct: 960 SGIHID 965 >SB_32252| Best HMM Match : RVT_1 (HMM E-Value=9.2e-21) Length = 1033 Score = 33.5 bits (73), Expect = 0.19 Identities = 16/38 (42%), Positives = 22/38 (57%) Frame = +2 Query: 323 LLQDTLLELNCGRRYGLVGLNGCGKSSLLAALGRREVP 436 +L+D + + + G+VG G GKSSLLA L R P Sbjct: 891 VLKDVSVHIKPAEKVGIVGRTGAGKSSLLATLFRMAEP 928 >SB_36385| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1308 Score = 33.5 bits (73), Expect = 0.19 Identities = 20/55 (36%), Positives = 30/55 (54%), Gaps = 2/55 (3%) Frame = +2 Query: 266 PRSRDIKIANFSITFYGSE--LLQDTLLELNCGRRYGLVGLNGCGKSSLLAALGR 424 P + +IKI + + + S L+D ++ G + G+VG G GKSSL AL R Sbjct: 896 PNTGNIKIDSLDLRYRESLPLALKDISCDIQPGEKIGIVGRTGAGKSSLSLALFR 950 >SB_35301| Best HMM Match : ABC_tran (HMM E-Value=0) Length = 618 Score = 33.1 bits (72), Expect = 0.25 Identities = 20/59 (33%), Positives = 29/59 (49%), Gaps = 2/59 (3%) Frame = +2 Query: 266 PRSRDIKIANFSITFYGS--ELLQDTLLELNCGRRYGLVGLNGCGKSSLLAALGRREVP 436 P I N S +++ S E+L + + + G+VG G GKSSLL+ L R P Sbjct: 30 PDKGKITFDNMSFSYHQSLPEVLHNVTCVIKPSEKVGVVGRTGAGKSSLLSTLFRLAEP 88 >SB_45078| Best HMM Match : ABC_tran (HMM E-Value=2.6e-36) Length = 972 Score = 32.7 bits (71), Expect = 0.33 Identities = 16/27 (59%), Positives = 18/27 (66%) Frame = +2 Query: 356 GRRYGLVGLNGCGKSSLLAALGRREVP 436 G + G+VG NG KSSLLAAL R P Sbjct: 830 GEKVGIVGRNGLEKSSLLAALLRLNTP 856 >SB_22546| Best HMM Match : ABC_tran (HMM E-Value=0) Length = 844 Score = 32.7 bits (71), Expect = 0.33 Identities = 15/35 (42%), Positives = 24/35 (68%) Frame = +2 Query: 320 ELLQDTLLELNCGRRYGLVGLNGCGKSSLLAALGR 424 ++L+ LE+N G+ LVG +GCGKS+ ++ L R Sbjct: 683 KVLRGLSLEVNQGQTLALVGPSGCGKSTTVSLLER 717 Score = 29.1 bits (62), Expect = 4.0 Identities = 13/35 (37%), Positives = 22/35 (62%) Frame = +2 Query: 320 ELLQDTLLELNCGRRYGLVGLNGCGKSSLLAALGR 424 ++L+ L + G+ LVG +GCGKS+L+ + R Sbjct: 133 KVLKGLHLTIRSGQTVALVGESGCGKSTLIKLVQR 167 >SB_49365| Best HMM Match : ABC_tran (HMM E-Value=3.5e-38) Length = 283 Score = 31.9 bits (69), Expect = 0.57 Identities = 18/61 (29%), Positives = 33/61 (54%), Gaps = 3/61 (4%) Frame = +2 Query: 281 IKIANFSITFY--GSELLQDTLLELNCGRRYGLVGLNGCGKSSLLAALGRR-EVPIPEHI 451 + ++ S+ +Y G ++L+ + ++ G+ G G GKSS++A+L R E HI Sbjct: 54 VSFSHVSLRYYSDGPQVLKGVTFSVEPQQKIGVAGRTGAGKSSIVASLMRMPEASTGIHI 113 Query: 452 D 454 D Sbjct: 114 D 114 >SB_40653| Best HMM Match : ABC_tran (HMM E-Value=0) Length = 672 Score = 31.9 bits (69), Expect = 0.57 Identities = 14/34 (41%), Positives = 21/34 (61%) Frame = +2 Query: 323 LLQDTLLELNCGRRYGLVGLNGCGKSSLLAALGR 424 +++ E+N G + G+VG G GKS+L AL R Sbjct: 437 VIKKLTFEINSGEKIGIVGRTGAGKSTLSLALFR 470 >SB_46433| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1011 Score = 31.9 bits (69), Expect = 0.57 Identities = 21/57 (36%), Positives = 31/57 (54%), Gaps = 2/57 (3%) Frame = +2 Query: 281 IKIANFSITFY--GSELLQDTLLELNCGRRYGLVGLNGCGKSSLLAALGRREVPIPE 445 I N S+++ G + L + E+ R +VG G GKSSL+AAL ++P PE Sbjct: 778 ITCKNLSLSYQKEGPKALHNLYFEVKPRERISIVGKAGAGKSSLVAAL--FQMPPPE 832 Score = 29.9 bits (64), Expect = 2.3 Identities = 18/39 (46%), Positives = 22/39 (56%), Gaps = 3/39 (7%) Frame = +2 Query: 311 YGS---ELLQDTLLELNCGRRYGLVGLNGCGKSSLLAAL 418 YGS +L D L+L R G+ G G GKSSLL A+ Sbjct: 256 YGSLAKSVLSDITLKLKGSRLIGITGPCGSGKSSLLLAI 294 >SB_52656| Best HMM Match : ABC_tran (HMM E-Value=0) Length = 1321 Score = 30.7 bits (66), Expect = 1.3 Identities = 15/38 (39%), Positives = 21/38 (55%) Frame = +2 Query: 323 LLQDTLLELNCGRRYGLVGLNGCGKSSLLAALGRREVP 436 +L++ + + G+VG G GKSSLLA L R P Sbjct: 772 VLKNVKFSIRNNEKVGIVGRTGAGKSSLLAVLFRLNNP 809 >SB_36388| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1570 Score = 30.7 bits (66), Expect = 1.3 Identities = 17/42 (40%), Positives = 23/42 (54%) Frame = +2 Query: 293 NFSITFYGSELLQDTLLELNCGRRYGLVGLNGCGKSSLLAAL 418 +FS G L + L + G +VG GCGKS+LL+AL Sbjct: 553 SFSWDVTGQPTLHNINLNIPDGSLVAVVGQVGCGKSTLLSAL 594 Score = 30.7 bits (66), Expect = 1.3 Identities = 17/55 (30%), Positives = 31/55 (56%), Gaps = 2/55 (3%) Frame = +2 Query: 266 PRSRDIKIANFSITFYGSE--LLQDTLLELNCGRRYGLVGLNGCGKSSLLAALGR 424 P I+I +F + + + +L++ +++ G + G+VG G GKS+L AL R Sbjct: 1327 PDKGRIQIEDFDLRYRANLPLVLKNISVDIQPGEKIGIVGRTGAGKSTLTLALFR 1381 >SB_16163| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 853 Score = 29.9 bits (64), Expect = 2.3 Identities = 16/66 (24%), Positives = 31/66 (46%) Frame = +2 Query: 509 VMEVDEERVKLEKLAEMLAHCEDDESQEQLMDVYDRLDDLSADTAEARAANILHGLGFXQ 688 ++ D+E++ + +L + E EQL ++ D++ +LS A +L G Sbjct: 520 ILHCDQEKLSESAIESLLKYLPSPEQMEQLSNMKDQISELSEPEQFAVHLILLMGNYMNT 579 Query: 689 GNAXEG 706 G+ EG Sbjct: 580 GSRNEG 585 >SB_38475| Best HMM Match : ASC (HMM E-Value=3.1e-14) Length = 421 Score = 29.9 bits (64), Expect = 2.3 Identities = 16/47 (34%), Positives = 27/47 (57%) Frame = +2 Query: 491 KTALQCVMEVDEERVKLEKLAEMLAHCEDDESQEQLMDVYDRLDDLS 631 +T Q MEV+E +++ + L + L E + S+ Q D +LD+LS Sbjct: 342 ETVRQREMEVEELQMQNQNLLQRLEAVESETSRAQYHDSMQKLDNLS 388 >SB_46345| Best HMM Match : AAA_5 (HMM E-Value=0.053) Length = 636 Score = 29.5 bits (63), Expect = 3.0 Identities = 11/24 (45%), Positives = 15/24 (62%) Frame = -2 Query: 647 PLPCRRSNRPDDRIHPSIAPVIHH 576 P CRR+ DR H ++PV+HH Sbjct: 352 PAVCRRTWTKHDRHHSILSPVVHH 375 >SB_30376| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1758 Score = 29.5 bits (63), Expect = 3.0 Identities = 17/47 (36%), Positives = 26/47 (55%), Gaps = 2/47 (4%) Frame = +2 Query: 284 KIANFSITFYGSE--LLQDTLLELNCGRRYGLVGLNGCGKSSLLAAL 418 K+ N S + G+E L+ D L G+ + G+ GCGK+SLL + Sbjct: 1546 KLINVSYSIPGTEEPLVADLDLVFARGQNVLITGMAGCGKTSLLRVI 1592 >SB_29576| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1202 Score = 29.1 bits (62), Expect = 4.0 Identities = 12/29 (41%), Positives = 16/29 (55%) Frame = -1 Query: 453 SMCSGIGTSRRPKAASNDDFPHPLSPTSP 367 +M + SR P SN P P+SP+SP Sbjct: 227 AMLVSLSNSRNPTPFSNPTTPRPISPSSP 255 >SB_52472| Best HMM Match : ABC_tran (HMM E-Value=4.62428e-44) Length = 322 Score = 29.1 bits (62), Expect = 4.0 Identities = 15/39 (38%), Positives = 19/39 (48%) Frame = +2 Query: 302 ITFYGSELLQDTLLELNCGRRYGLVGLNGCGKSSLLAAL 418 IT G ++ E+ G + G NGCGKSSL L Sbjct: 75 ITPCGDVVVSSLAFEMQPGMHLLITGPNGCGKSSLFRIL 113 >SB_26965| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 827 Score = 29.1 bits (62), Expect = 4.0 Identities = 14/52 (26%), Positives = 27/52 (51%) Frame = +2 Query: 524 EERVKLEKLAEMLAHCEDDESQEQLMDVYDRLDDLSADTAEARAANILHGLG 679 EE K+ + + E++E +E+ M+ Y+ LD+ A N++H +G Sbjct: 84 EEAEKVVVVESDTSEDEEEEEEEETMESYNELDEPQATYDVIDTYNVMHVVG 135 >SB_20094| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 374 Score = 29.1 bits (62), Expect = 4.0 Identities = 18/69 (26%), Positives = 35/69 (50%), Gaps = 2/69 (2%) Frame = +2 Query: 218 KMNSEARSCTGSLAVHPRSRDIKIANFSITFYGSE--LLQDTLLELNCGRRYGLVGLNGC 391 +M+ E + L P DI I + S + GS+ +L++ + + + +VG +G Sbjct: 203 EMDDEVQGEKDKLTDIPCDEDIIIKDLSFRYLGSDTNVLKELNMTIPAKKITAIVGTSGS 262 Query: 392 GKSSLLAAL 418 GK++L+ L Sbjct: 263 GKTTLMKLL 271 >SB_40840| Best HMM Match : ABC-3 (HMM E-Value=2.4) Length = 235 Score = 28.7 bits (61), Expect = 5.3 Identities = 13/26 (50%), Positives = 18/26 (69%) Frame = +2 Query: 341 LELNCGRRYGLVGLNGCGKSSLLAAL 418 L++ G +VG GCGKS+LL+AL Sbjct: 196 LDVPAGSLVAVVGQVGCGKSTLLSAL 221 >SB_52342| Best HMM Match : ABC_tran (HMM E-Value=5.29999e-41) Length = 336 Score = 28.3 bits (60), Expect = 7.0 Identities = 15/44 (34%), Positives = 25/44 (56%) Frame = +2 Query: 293 NFSITFYGSELLQDTLLELNCGRRYGLVGLNGCGKSSLLAALGR 424 NF T+Y +L++ + G+ LVG +G GKS+++ L R Sbjct: 147 NFFGTYYRKPVLKNISFTVFPGQTLALVGNSGGGKSTIIRLLYR 190 >SB_34083| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 580 Score = 28.3 bits (60), Expect = 7.0 Identities = 15/32 (46%), Positives = 20/32 (62%) Frame = +2 Query: 323 LLQDTLLELNCGRRYGLVGLNGCGKSSLLAAL 418 LL L + G+ G++G G GKSSLL+AL Sbjct: 79 LLSGLNLSIRKGQLIGVIGGVGSGKSSLLSAL 110 >SB_30636| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 285 Score = 28.3 bits (60), Expect = 7.0 Identities = 17/43 (39%), Positives = 25/43 (58%), Gaps = 1/43 (2%) Frame = +2 Query: 311 YGS-ELLQDTLLELNCGRRYGLVGLNGCGKSSLLAALGRREVP 436 YGS E+L+ L++ G L+G +G GKS+LL + E P Sbjct: 31 YGSNEVLKGISLDVAPGEVVCLIGPSGSGKSTLLRCVNLLEQP 73 >SB_26398| Best HMM Match : Protamine_P2 (HMM E-Value=4) Length = 159 Score = 28.3 bits (60), Expect = 7.0 Identities = 14/53 (26%), Positives = 27/53 (50%) Frame = +2 Query: 521 DEERVKLEKLAEMLAHCEDDESQEQLMDVYDRLDDLSADTAEARAANILHGLG 679 D + + EK+ + + D+E ++ M+ Y+ LD+ A NI+H +G Sbjct: 72 DTDGEEAEKVVVVESDTRDEEEDKKSMESYNELDEPQATYDVIDTYNIMHVVG 124 >SB_20258| Best HMM Match : Exo_endo_phos (HMM E-Value=7.1e-16) Length = 525 Score = 28.3 bits (60), Expect = 7.0 Identities = 18/65 (27%), Positives = 33/65 (50%) Frame = +2 Query: 266 PRSRDIKIANFSITFYGSELLQDTLLELNCGRRYGLVGLNGCGKSSLLAALGRREVPIPE 445 P+S K+ NF+ TF+ ++L+++ + R L+ L K +A G VP+ + Sbjct: 195 PKSDKQKLLNFARTFHFTQLVKEPTRITDTSRT--LIDLIFVNKEHRIAISGVVPVPLSD 252 Query: 446 HIDIF 460 H +F Sbjct: 253 HYLVF 257 >SB_35286| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 564 Score = 28.3 bits (60), Expect = 7.0 Identities = 13/27 (48%), Positives = 16/27 (59%) Frame = +2 Query: 356 GRRYGLVGLNGCGKSSLLAALGRREVP 436 G GLVG NG GKS+ L L ++ P Sbjct: 111 GEVLGLVGTNGIGKSTALKILAGKQKP 137 >SB_14872| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1182 Score = 28.3 bits (60), Expect = 7.0 Identities = 18/65 (27%), Positives = 33/65 (50%) Frame = +2 Query: 266 PRSRDIKIANFSITFYGSELLQDTLLELNCGRRYGLVGLNGCGKSSLLAALGRREVPIPE 445 P+S K+ NF+ TF+ ++L+++ + R L+ L K +A G VP+ + Sbjct: 69 PKSDKQKLLNFARTFHFTQLVKEPTRITDTSRT--LIDLIFVNKEHRIAISGVVPVPLSD 126 Query: 446 HIDIF 460 H +F Sbjct: 127 HYLVF 131 >SB_10268| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 421 Score = 28.3 bits (60), Expect = 7.0 Identities = 15/47 (31%), Positives = 28/47 (59%) Frame = +2 Query: 317 SELLQDTLLELNCGRRYGLVGLNGCGKSSLLAALGRREVPIPEHIDI 457 +E+L+ ++N G LVG +G GKS++++ + R P+ +I I Sbjct: 173 TEVLKALSFKINPGETVALVGPSGGGKSTVISLIERFYDPMTGNIRI 219 >SB_39061| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2362 Score = 27.9 bits (59), Expect = 9.3 Identities = 18/65 (27%), Positives = 33/65 (50%) Frame = +2 Query: 266 PRSRDIKIANFSITFYGSELLQDTLLELNCGRRYGLVGLNGCGKSSLLAALGRREVPIPE 445 P+S K+ NF+ TF+ ++L+++ + R L+ L K +A G VP+ + Sbjct: 1795 PKSDKQKLLNFARTFHFTQLVKEPTRITDTSRT--LIDLIFVNKEHRIANSGVVPVPLSD 1852 Query: 446 HIDIF 460 H +F Sbjct: 1853 HYLVF 1857 >SB_48818| Best HMM Match : Exo_endo_phos (HMM E-Value=0.00029) Length = 318 Score = 27.9 bits (59), Expect = 9.3 Identities = 18/65 (27%), Positives = 33/65 (50%) Frame = +2 Query: 266 PRSRDIKIANFSITFYGSELLQDTLLELNCGRRYGLVGLNGCGKSSLLAALGRREVPIPE 445 P+S K+ NF+ TF+ ++L+++ + R L+ L K +A G VP+ + Sbjct: 135 PKSDKQKLLNFARTFHFTQLVKEPTRITDTSRT--LIDLIFVNKEHRIANSGVVPVPLSD 192 Query: 446 HIDIF 460 H +F Sbjct: 193 HYLVF 197 >SB_48424| Best HMM Match : PSI (HMM E-Value=0.4) Length = 175 Score = 27.9 bits (59), Expect = 9.3 Identities = 9/17 (52%), Positives = 11/17 (64%) Frame = +1 Query: 646 GACC*YPAWSWLXPREC 696 G C YP W+ L PR+C Sbjct: 57 GVCSHYPGWTKLVPRDC 73 >SB_42532| Best HMM Match : Exo_endo_phos (HMM E-Value=7.2e-16) Length = 399 Score = 27.9 bits (59), Expect = 9.3 Identities = 18/65 (27%), Positives = 33/65 (50%) Frame = +2 Query: 266 PRSRDIKIANFSITFYGSELLQDTLLELNCGRRYGLVGLNGCGKSSLLAALGRREVPIPE 445 P+S K+ NF+ TF+ ++L+++ + R L+ L K +A G VP+ + Sbjct: 195 PKSDKQKLLNFARTFHFTQLVKEPTRITDTSRT--LIDLIFVNKEHRIANSGVVPVPLSD 252 Query: 446 HIDIF 460 H +F Sbjct: 253 HYLVF 257 >SB_7365| Best HMM Match : ABC_membrane (HMM E-Value=0) Length = 1301 Score = 27.9 bits (59), Expect = 9.3 Identities = 12/35 (34%), Positives = 21/35 (60%) Frame = +2 Query: 320 ELLQDTLLELNCGRRYGLVGLNGCGKSSLLAALGR 424 ++L L + G+ LVG +GCGKS+++ + R Sbjct: 668 KVLNGLSLTVRSGQTVALVGESGCGKSTVIKLIQR 702 >SB_4370| Best HMM Match : PSI (HMM E-Value=0.4) Length = 175 Score = 27.9 bits (59), Expect = 9.3 Identities = 9/17 (52%), Positives = 11/17 (64%) Frame = +1 Query: 646 GACC*YPAWSWLXPREC 696 G C YP W+ L PR+C Sbjct: 57 GVCSHYPGWTKLVPRDC 73 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 21,584,742 Number of Sequences: 59808 Number of extensions: 425473 Number of successful extensions: 941 Number of sequences better than 10.0: 52 Number of HSP's better than 10.0 without gapping: 868 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 941 length of database: 16,821,457 effective HSP length: 80 effective length of database: 12,036,817 effective search space used: 2034222073 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -