Bombyx BLAST Result against bee

BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= brP-0312
         (750 letters)

Database: bee 
           438 sequences; 146,343 total letters

Searching......................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AY313893-1|AAQ82184.1|  437|Apis mellifera major royal jelly pro...    26   0.43 
AF004842-1|AAD01205.1|  598|Apis mellifera major royal jelly pro...    23   4.0  
AB270697-1|BAF75928.1|  735|Apis mellifera FoxP protein protein.       22   5.3  
DQ000307-1|AAY21180.1|  423|Apis mellifera major royal jelly pro...    22   7.1  

>AY313893-1|AAQ82184.1|  437|Apis mellifera major royal jelly
           protein MRJP6 protein.
          Length = 437

 Score = 25.8 bits (54), Expect = 0.43
 Identities = 12/35 (34%), Positives = 15/35 (42%), Gaps = 2/35 (5%)
 Frame = +1

Query: 598 DGCIRSSGRFERRHGRGACC*--YPAWSWLXPREC 696
           DG   S      + G G C    YP WSW   ++C
Sbjct: 88  DGVPSSLNVISEKIGNGGCLLQPYPDWSWANYKDC 122


>AF004842-1|AAD01205.1|  598|Apis mellifera major royal jelly
           protein MRJP5 protein.
          Length = 598

 Score = 22.6 bits (46), Expect = 4.0
 Identities = 6/12 (50%), Positives = 8/12 (66%)
 Frame = +1

Query: 661 YPAWSWLXPREC 696
           YP WSW   ++C
Sbjct: 111 YPDWSWANYKDC 122


>AB270697-1|BAF75928.1|  735|Apis mellifera FoxP protein protein.
          Length = 735

 Score = 22.2 bits (45), Expect = 5.3
 Identities = 9/40 (22%), Positives = 20/40 (50%)
 Frame = +3

Query: 438 FRNTLTYSI*LEKCLLQIRLHFSASWRLTRRESNSRSSQK 557
           ++N + +++ L KC +++     A W +   E   R  Q+
Sbjct: 548 WKNAVRHNLSLHKCFMRVENVKGAVWTVDEVEFYKRRPQR 587


>DQ000307-1|AAY21180.1|  423|Apis mellifera major royal jelly
           protein 9 protein.
          Length = 423

 Score = 21.8 bits (44), Expect = 7.1
 Identities = 6/12 (50%), Positives = 7/12 (58%)
 Frame = +1

Query: 661 YPAWSWLXPREC 696
           YP WSW   + C
Sbjct: 108 YPNWSWAKNQNC 119


  Database: bee
    Posted date:  Oct 23, 2007  1:17 PM
  Number of letters in database: 146,343
  Number of sequences in database:  438
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 187,976
Number of Sequences: 438
Number of extensions: 3942
Number of successful extensions: 5
Number of sequences better than 10.0: 4
Number of HSP's better than 10.0 without gapping: 5
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 5
length of database: 146,343
effective HSP length: 56
effective length of database: 121,815
effective search space used: 23510295
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)