BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= brP-0311 (800 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPBC25B2.11 |pof2||F-box protein Pof2|Schizosaccharomyces pombe|... 27 2.3 SPAC16.03c |ura2||dihydroorotase Ura2 |Schizosaccharomyces pombe... 26 5.4 SPBP19A11.07c ||SPBP4H10.02c|human down-regulated in multiple ca... 25 9.5 SPBC336.05c |||S-adenosylmethionine-dependentmethyltransferase|S... 25 9.5 >SPBC25B2.11 |pof2||F-box protein Pof2|Schizosaccharomyces pombe|chr 2|||Manual Length = 463 Score = 27.5 bits (58), Expect = 2.3 Identities = 14/30 (46%), Positives = 16/30 (53%) Frame = +2 Query: 347 VKCIWRRKLSFRMLSSWYCRNLRRCRSSIC 436 VKCI LS +LS + RNL R S C Sbjct: 362 VKCICLTDLSVILLSGSFSRNLERVHLSYC 391 >SPAC16.03c |ura2||dihydroorotase Ura2 |Schizosaccharomyces pombe|chr 1|||Manual Length = 337 Score = 26.2 bits (55), Expect = 5.4 Identities = 11/16 (68%), Positives = 12/16 (75%) Frame = -2 Query: 676 GSDSATHPIGSFIKTP 629 GSDSA HP S +KTP Sbjct: 238 GSDSAPHPRSSKLKTP 253 >SPBP19A11.07c ||SPBP4H10.02c|human down-regulated in multiple cancers-1 homolog 2|Schizosaccharomyces pombe|chr 2|||Manual Length = 676 Score = 25.4 bits (53), Expect = 9.5 Identities = 14/30 (46%), Positives = 19/30 (63%) Frame = +2 Query: 152 IHEIRFSCNSSLIVSTPASDLYVLTLVSFV 241 I E+ FS +S IVS A D+Y+ + SFV Sbjct: 220 IDELDFSVLNS-IVSLDAKDIYIRVICSFV 248 >SPBC336.05c |||S-adenosylmethionine- dependentmethyltransferase|Schizosaccharomyces pombe|chr 2|||Manual Length = 378 Score = 25.4 bits (53), Expect = 9.5 Identities = 13/29 (44%), Positives = 20/29 (68%) Frame = +3 Query: 441 ERRRELNKLDRTGTSVTIKILLPVGCGDS 527 +RRR+L K+ + G V + LL +GCGD+ Sbjct: 13 QRRRKLFKILQGGFPV--RSLLDIGCGDA 39 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 3,117,186 Number of Sequences: 5004 Number of extensions: 61963 Number of successful extensions: 99 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 96 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 99 length of database: 2,362,478 effective HSP length: 72 effective length of database: 2,002,190 effective search space used: 388424860 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -