BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= brP-0308 (700 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value DQ011228-1|AAY63897.1| 486|Apis mellifera Amt-2-like protein pr... 24 1.2 AY855337-1|AAW47987.1| 510|Apis mellifera tyrosine hydroxylase ... 24 1.2 AY686596-1|AAT96374.1| 1946|Apis mellifera Dscam protein. 22 6.4 >DQ011228-1|AAY63897.1| 486|Apis mellifera Amt-2-like protein protein. Length = 486 Score = 24.2 bits (50), Expect = 1.2 Identities = 20/73 (27%), Positives = 32/73 (43%), Gaps = 2/73 (2%) Frame = +1 Query: 124 CHRFLISGNDVKVVVASLYPTALSDASEVFRALSG--FKVRNRSLYRDRSGMYANVSRTV 297 C + +I+G V A YP A+ V A+ F + +R ++R Y N+ T Sbjct: 312 CVQAMIAGIVVISAGADAYPPL---AAIVLGAIGSIVFYIISRYVFRSALEDYCNIVATH 368 Query: 298 SGCGVSGELFWSF 336 CG+ G + F Sbjct: 369 LVCGILGSILVPF 381 >AY855337-1|AAW47987.1| 510|Apis mellifera tyrosine hydroxylase protein. Length = 510 Score = 24.2 bits (50), Expect = 1.2 Identities = 21/104 (20%), Positives = 41/104 (39%), Gaps = 2/104 (1%) Frame = -3 Query: 572 YNRLTLTVPRHLVRT*SER*S-LTESKVFGDDDIEVNEVKKTDKYLFKKNDYIR*SS*RK 396 +N L VP+H + E K+F + + ++++ ++L K + + Sbjct: 244 FNTLVDLVPKHACAEYRRNFKKMQEEKIF--EPHRIPQLQEVSEFLKKNTGFTLRPAAGL 301 Query: 395 YIQIDFESGVXXXXXXXXXXXXXKSSP-DTPQPDTVRDTLAYIP 267 DF S + SP TP+PD + + L ++P Sbjct: 302 LTSRDFLSSLAFRVFQSTQYIRHIKSPYHTPEPDCIHELLGHMP 345 >AY686596-1|AAT96374.1| 1946|Apis mellifera Dscam protein. Length = 1946 Score = 21.8 bits (44), Expect = 6.4 Identities = 18/63 (28%), Positives = 26/63 (41%) Frame = -1 Query: 475 LKLMRSRKPTNIFLKKTIIFDSLVKENTYKLTSNQECY*NGSVLNY*NSRKVHPTLHNLT 296 LK + S PT + T D NT +L Q NG V+++ N H L Sbjct: 413 LKCVASGNPTP---EITWELDGKRLSNTERLQVGQYVTVNGDVVSHLNISSTHTNDGGLY 469 Query: 295 QCV 287 +C+ Sbjct: 470 KCI 472 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 170,051 Number of Sequences: 438 Number of extensions: 3289 Number of successful extensions: 4 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 4 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 4 length of database: 146,343 effective HSP length: 56 effective length of database: 121,815 effective search space used: 21439440 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -