BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= brP-0307 (749 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_29595| Best HMM Match : RNA_pol_Rpb2_6 (HMM E-Value=1.90001e-40) 29 3.0 SB_42530| Best HMM Match : ELFV_dehydrog_N (HMM E-Value=0) 28 9.3 SB_37813| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 9.3 >SB_29595| Best HMM Match : RNA_pol_Rpb2_6 (HMM E-Value=1.90001e-40) Length = 700 Score = 29.5 bits (63), Expect = 3.0 Identities = 20/82 (24%), Positives = 37/82 (45%), Gaps = 3/82 (3%) Frame = -3 Query: 396 FHQESEIFIRSPAGAAEDDAGSIGSWFQNAVHILSKGSF--LESFIRFLVFGCSKHGVV- 226 FHQ + R+ + D+GSI F++ H + S+ L+ IRF + K + Sbjct: 207 FHQRQPLAGRNDGAWTKSDSGSIEEGFESDRHFIDAKSWHDLQEKIRFTSYAGRKDNLEN 266 Query: 225 LSHLDVPVVLLQQRQWLEYLRW 160 S+L ++ + E+ +W Sbjct: 267 FSYLPTTIMSVINNGTPEFAQW 288 >SB_42530| Best HMM Match : ELFV_dehydrog_N (HMM E-Value=0) Length = 520 Score = 27.9 bits (59), Expect = 9.3 Identities = 12/32 (37%), Positives = 19/32 (59%) Frame = +1 Query: 22 HMLVRMARSTERFFGQSSHFNLCVTYAMKEDL 117 H+L + +S ER FG SSH + + A +E + Sbjct: 428 HLLESVQKSLERHFGGSSHIPITPSEAFQEQI 459 >SB_37813| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 450 Score = 27.9 bits (59), Expect = 9.3 Identities = 14/40 (35%), Positives = 19/40 (47%) Frame = -3 Query: 246 CSKHGVVLSHLDVPVVLLQQRQWLEYLRWPVVKDSSIDVP 127 C V LSHL + L WL+ L PV+ ++VP Sbjct: 150 CGAGSVWLSHLKKDKLKLPATYWLKDLEVPVLPSPPVEVP 189 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 18,901,593 Number of Sequences: 59808 Number of extensions: 346318 Number of successful extensions: 1642 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 1577 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1641 length of database: 16,821,457 effective HSP length: 80 effective length of database: 12,036,817 effective search space used: 2034222073 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -