BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= brP-0307 (749 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value DQ342041-1|ABC69933.1| 828|Apis mellifera STIP protein. 25 0.57 AB161182-1|BAD08344.1| 1040|Apis mellifera metabotropic glutamat... 23 4.0 AF469010-1|AAL93136.1| 678|Apis mellifera cGMP-dependent protei... 22 5.3 AF004169-1|AAC13418.1| 371|Apis mellifera ultraviolet-sensitive... 22 7.1 >DQ342041-1|ABC69933.1| 828|Apis mellifera STIP protein. Length = 828 Score = 25.4 bits (53), Expect = 0.57 Identities = 9/33 (27%), Positives = 18/33 (54%) Frame = +1 Query: 211 VKMAQNYPMFGASKHEKPNEAFEKTAFTEYVDG 309 +K + +P +S E+PN ++ +F+ DG Sbjct: 98 IKSQKEFPNSSSSDDERPNSIHQRASFSLNTDG 130 >AB161182-1|BAD08344.1| 1040|Apis mellifera metabotropic glutamate receptor protein. Length = 1040 Score = 22.6 bits (46), Expect = 4.0 Identities = 16/40 (40%), Positives = 20/40 (50%) Frame = -3 Query: 285 SFLESFIRFLVFGCSKHGVVLSHLDVPVVLLQQRQWLEYL 166 SF + I +F C GV L H D PVV R+ L Y+ Sbjct: 662 SFSATGILITLFVC---GVFLKHNDTPVVRASGRE-LSYV 697 >AF469010-1|AAL93136.1| 678|Apis mellifera cGMP-dependent protein kinase foraging protein. Length = 678 Score = 22.2 bits (45), Expect = 5.3 Identities = 5/28 (17%), Positives = 17/28 (60%) Frame = -3 Query: 195 LQQRQWLEYLRWPVVKDSSIDVPILQQI 112 +Q+ +W + W ++ +++ PI+ ++ Sbjct: 620 IQKHKWFDGFNWEGLRARTLEPPIMPRV 647 >AF004169-1|AAC13418.1| 371|Apis mellifera ultraviolet-sensitive opsin protein. Length = 371 Score = 21.8 bits (44), Expect = 7.1 Identities = 9/16 (56%), Positives = 11/16 (68%) Frame = +1 Query: 136 NAAVLYDRPPKIFKPL 183 NAA+ YDR I +PL Sbjct: 138 NAAIAYDRYSTIARPL 153 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 164,566 Number of Sequences: 438 Number of extensions: 3205 Number of successful extensions: 5 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 4 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 5 length of database: 146,343 effective HSP length: 56 effective length of database: 121,815 effective search space used: 23510295 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -