BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= brP-0304 (750 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AB193550-1|BAD66824.1| 699|Apis mellifera soluble guanylyl cycl... 26 0.33 DQ435329-1|ABD92644.1| 150|Apis mellifera OBP12 protein. 24 1.8 AY463910-1|AAR24352.1| 843|Apis mellifera metabotropic glutamat... 23 2.3 AY395072-1|AAQ96728.1| 593|Apis mellifera GABA neurotransmitter... 23 2.3 AB161181-1|BAD08343.1| 933|Apis mellifera metabotropic glutamat... 23 2.3 AB264313-1|BAF43600.1| 900|Apis mellifera ecdysone-induced prot... 22 5.3 AY395071-1|AAQ96727.1| 646|Apis mellifera GABA neurotransmitter... 22 7.1 AB181702-1|BAE06051.1| 628|Apis mellifera acetylcholinesterase ... 22 7.1 AB161182-1|BAD08344.1| 1040|Apis mellifera metabotropic glutamat... 21 9.3 >AB193550-1|BAD66824.1| 699|Apis mellifera soluble guanylyl cyclase alpha 1 subunit protein. Length = 699 Score = 26.2 bits (55), Expect = 0.33 Identities = 14/56 (25%), Positives = 27/56 (48%) Frame = +2 Query: 368 RHAHGDQYKAQDFVVPKPGKVELVYTTRDGTTERRVLYDFKTPGVAMGMYNTDESI 535 +H G + +A+ + P +EL +TT + ++ K G+A YN D ++ Sbjct: 182 QHQSGSEAEAEFVCIATPEAIELHFTTDHPSVAYLLVGSLK--GIARQFYNDDANV 235 >DQ435329-1|ABD92644.1| 150|Apis mellifera OBP12 protein. Length = 150 Score = 23.8 bits (49), Expect = 1.8 Identities = 8/25 (32%), Positives = 14/25 (56%) Frame = +2 Query: 476 LYDFKTPGVAMGMYNTDESIRSFAH 550 L + G+ G Y+ DE +++F H Sbjct: 87 LSTYNIAGIIEGQYHDDEDLKTFFH 111 >AY463910-1|AAR24352.1| 843|Apis mellifera metabotropic glutamate receptor 1 protein. Length = 843 Score = 23.4 bits (48), Expect = 2.3 Identities = 9/27 (33%), Positives = 15/27 (55%) Frame = -2 Query: 590 IEAIFSVKLPENWNGQRTESIRRYCTC 510 + A+ + K+PEN+N + Y TC Sbjct: 690 VYAVKTRKIPENFNESKFIGFTMYTTC 716 >AY395072-1|AAQ96728.1| 593|Apis mellifera GABA neurotransmitter transporter-1B protein. Length = 593 Score = 23.4 bits (48), Expect = 2.3 Identities = 12/28 (42%), Positives = 13/28 (46%) Frame = +2 Query: 359 VIGRHAHGDQYKAQDFVVPKPGKVELVY 442 V+G AH Q D V PG LVY Sbjct: 336 VVGFMAHEQQKPVADVAVSGPGLAFLVY 363 >AB161181-1|BAD08343.1| 933|Apis mellifera metabotropic glutamate receptor protein. Length = 933 Score = 23.4 bits (48), Expect = 2.3 Identities = 9/27 (33%), Positives = 15/27 (55%) Frame = -2 Query: 590 IEAIFSVKLPENWNGQRTESIRRYCTC 510 + A+ + K+PEN+N + Y TC Sbjct: 780 VYAVKTRKIPENFNESKFIGFTMYTTC 806 >AB264313-1|BAF43600.1| 900|Apis mellifera ecdysone-induced protein 75 protein. Length = 900 Score = 22.2 bits (45), Expect = 5.3 Identities = 11/50 (22%), Positives = 21/50 (42%) Frame = -3 Query: 475 YTPLCRTISCSVNKFNLSGFRYNKILRLVLVAVRMTAYHNRFRPTRHNPR 326 Y P + CS+ + N + +Y ++ + + V + A P R R Sbjct: 101 YRPCTKNQQCSILRINRNRCQYCRLKKCIAVGMSRDAVRFGRVPKREKAR 150 >AY395071-1|AAQ96727.1| 646|Apis mellifera GABA neurotransmitter transporter-1B protein. Length = 646 Score = 21.8 bits (44), Expect = 7.1 Identities = 11/28 (39%), Positives = 12/28 (42%) Frame = +2 Query: 359 VIGRHAHGDQYKAQDFVVPKPGKVELVY 442 V+G AH Q D PG LVY Sbjct: 389 VVGFMAHEQQKPVADVAASGPGLAFLVY 416 >AB181702-1|BAE06051.1| 628|Apis mellifera acetylcholinesterase protein. Length = 628 Score = 21.8 bits (44), Expect = 7.1 Identities = 8/15 (53%), Positives = 11/15 (73%) Frame = -3 Query: 580 FFL*SYLKTGMGKGP 536 +F+ KTG+GKGP Sbjct: 555 YFIFDAEKTGLGKGP 569 >AB161182-1|BAD08344.1| 1040|Apis mellifera metabotropic glutamate receptor protein. Length = 1040 Score = 21.4 bits (43), Expect = 9.3 Identities = 8/27 (29%), Positives = 14/27 (51%) Frame = -2 Query: 590 IEAIFSVKLPENWNGQRTESIRRYCTC 510 + A+ + K+PE +N + Y TC Sbjct: 832 VYAVLTRKIPEAFNESKHIGFTMYTTC 858 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 229,023 Number of Sequences: 438 Number of extensions: 5677 Number of successful extensions: 10 Number of sequences better than 10.0: 9 Number of HSP's better than 10.0 without gapping: 10 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 10 length of database: 146,343 effective HSP length: 56 effective length of database: 121,815 effective search space used: 23510295 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -