BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= brP-0301 (448 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_16236| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 4.0 SB_34007| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 5.3 SB_50821| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 7.1 >SB_16236| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2317 Score = 27.9 bits (59), Expect = 4.0 Identities = 20/80 (25%), Positives = 31/80 (38%) Frame = +3 Query: 12 TXKTSGAFVLKRCTGVRIPQAGTNFSNEIRTQQMFTIDFHGEGITSCNKNETRKIIICVI 191 T +T+ A + K T I GT + I T + T+ + + +I Sbjct: 1002 TDETTSASMTKHATAAPITTNGTT-AEPISTDGTTVLSMSTARTTTASMSTAGTTAAPII 1060 Query: 192 TGGRTSCESARVGTTAPPIS 251 T G T+ GTT P+S Sbjct: 1061 TNGTTAAPITTNGTTTEPMS 1080 >SB_34007| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1411 Score = 27.5 bits (58), Expect = 5.3 Identities = 14/52 (26%), Positives = 20/52 (38%) Frame = -1 Query: 403 HSPPDVKWLLEPIDIYNVNAPHTLRYIVLRSQYSHNGCPTLQTETHYCFTAE 248 HS + E D Y P T RY ++R + T+T C T + Sbjct: 983 HSTHGAAYRTEQCDTYQTGRPDTTRYGIVRHGVTRCSIVRFDTDTTRCNTVQ 1034 >SB_50821| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 81 Score = 27.1 bits (57), Expect = 7.1 Identities = 14/40 (35%), Positives = 18/40 (45%), Gaps = 3/40 (7%) Frame = -1 Query: 304 SHNGCPTLQTETHYCFT---AEIGGAVVPTRADSQEVLPP 194 SH C +TE+ CFT E PT+ +S L P Sbjct: 32 SHRVCTPTKTESQSCFTPTKTESQSCFTPTKTESPSCLHP 71 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 14,814,396 Number of Sequences: 59808 Number of extensions: 300996 Number of successful extensions: 663 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 575 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 659 length of database: 16,821,457 effective HSP length: 76 effective length of database: 12,276,049 effective search space used: 883875528 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -