BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= brP-0301 (448 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Z46794-6|CAA86776.1| 416|Caenorhabditis elegans Hypothetical pr... 27 6.2 U29096-2|AAX88830.1| 133|Caenorhabditis elegans Hypothetical pr... 27 8.2 AC084159-8|AAK39361.2| 655|Caenorhabditis elegans Hypothetical ... 27 8.2 >Z46794-6|CAA86776.1| 416|Caenorhabditis elegans Hypothetical protein R06F6.6 protein. Length = 416 Score = 27.1 bits (57), Expect = 6.2 Identities = 17/58 (29%), Positives = 28/58 (48%), Gaps = 1/58 (1%) Frame = -1 Query: 304 SHNGCPTLQTETHYCFTAEIGGAVVPTRADSQEVLPPVITQIIILRV-SFLLHDVIPS 134 S + PT T + +I A PT ADS + PP + II ++ F + ++P+ Sbjct: 211 SSDSTPTPTQATQFDMPTQIQTASPPTTADS-AIFPPTSPESIIQKIEQFPSNQILPN 267 >U29096-2|AAX88830.1| 133|Caenorhabditis elegans Hypothetical protein F30H5.5 protein. Length = 133 Score = 26.6 bits (56), Expect = 8.2 Identities = 14/42 (33%), Positives = 23/42 (54%), Gaps = 1/42 (2%) Frame = +3 Query: 21 TSGAFVLKRCTG-VRIPQAGTNFSNEIRTQQMFTIDFHGEGI 143 TS A +L+ ++ Q T NE T+Q+FT+D++ I Sbjct: 23 TSDAEILEITNAHIKAIQVATRSMNETATRQLFTLDYNNPKI 64 >AC084159-8|AAK39361.2| 655|Caenorhabditis elegans Hypothetical protein Y73B3A.3 protein. Length = 655 Score = 26.6 bits (56), Expect = 8.2 Identities = 14/69 (20%), Positives = 28/69 (40%) Frame = -1 Query: 319 LRSQYSHNGCPTLQTETHYCFTAEIGGAVVPTRADSQEVLPPVITQIIILRVSFLLHDVI 140 +R+ + CP +C A + ++P ++ I + IL S L D + Sbjct: 259 VRNLPKRHSCPKYDRHEEFCGAANLDSPIMPRHLSDEQRSSDAIFNVPILVASGLAPDSL 318 Query: 139 PSPWKSIVN 113 +S++N Sbjct: 319 RITLESLLN 327 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 10,800,116 Number of Sequences: 27780 Number of extensions: 221178 Number of successful extensions: 430 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 415 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 430 length of database: 12,740,198 effective HSP length: 75 effective length of database: 10,656,698 effective search space used: 777938954 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -