BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= brP-0299 (750 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AB264313-1|BAF43600.1| 900|Apis mellifera ecdysone-induced prot... 24 1.3 DQ325124-1|ABD14138.1| 179|Apis mellifera complementary sex det... 23 4.0 DQ325123-1|ABD14137.1| 179|Apis mellifera complementary sex det... 23 4.0 DQ011228-1|AAY63897.1| 486|Apis mellifera Amt-2-like protein pr... 22 7.1 DQ325122-1|ABD14136.1| 179|Apis mellifera complementary sex det... 21 9.3 DQ201783-1|ABB05503.1| 381|Apis mellifera capa receptor-like GP... 21 9.3 DQ000307-1|AAY21180.1| 423|Apis mellifera major royal jelly pro... 21 9.3 >AB264313-1|BAF43600.1| 900|Apis mellifera ecdysone-induced protein 75 protein. Length = 900 Score = 24.2 bits (50), Expect = 1.3 Identities = 11/33 (33%), Positives = 21/33 (63%) Frame = +3 Query: 408 VMRETLRCVVYLAPLSTF*LEKILWFRVTHMRK 506 ++RE L+ + L L+T EK+L F++T ++ Sbjct: 384 ILRELLKKIPDLRTLNTLHSEKLLAFKMTEQQQ 416 >DQ325124-1|ABD14138.1| 179|Apis mellifera complementary sex determiner protein. Length = 179 Score = 22.6 bits (46), Expect = 4.0 Identities = 10/23 (43%), Positives = 12/23 (52%) Frame = -1 Query: 210 LLNVYTRNNGGFLTLYHKVYKKI 142 L N Y NN + LY YKK+ Sbjct: 85 LSNNYNYNNNNYKKLYCNNYKKL 107 >DQ325123-1|ABD14137.1| 179|Apis mellifera complementary sex determiner protein. Length = 179 Score = 22.6 bits (46), Expect = 4.0 Identities = 10/23 (43%), Positives = 12/23 (52%) Frame = -1 Query: 210 LLNVYTRNNGGFLTLYHKVYKKI 142 L N Y NN + LY YKK+ Sbjct: 85 LSNNYNYNNNNYKKLYCNNYKKL 107 >DQ011228-1|AAY63897.1| 486|Apis mellifera Amt-2-like protein protein. Length = 486 Score = 21.8 bits (44), Expect = 7.1 Identities = 9/22 (40%), Positives = 14/22 (63%) Frame = -2 Query: 239 CFIVNLMLYSYLMYIHVIMVAF 174 C IV + L S +MYI I++ + Sbjct: 403 CLIVVIALVSIIMYIAFIILQY 424 >DQ325122-1|ABD14136.1| 179|Apis mellifera complementary sex determiner protein. Length = 179 Score = 21.4 bits (43), Expect = 9.3 Identities = 9/23 (39%), Positives = 12/23 (52%) Frame = -1 Query: 210 LLNVYTRNNGGFLTLYHKVYKKI 142 L N Y NN + LY Y+K+ Sbjct: 85 LSNNYNYNNNNYKKLYCNNYRKL 107 >DQ201783-1|ABB05503.1| 381|Apis mellifera capa receptor-like GPCR protein. Length = 381 Score = 21.4 bits (43), Expect = 9.3 Identities = 9/22 (40%), Positives = 12/22 (54%) Frame = -3 Query: 529 CIATGTLLLRMWVTRNHKIFSN 464 C T + R WVTR +I +N Sbjct: 344 CCKTRIIGRRSWVTRESQICNN 365 >DQ000307-1|AAY21180.1| 423|Apis mellifera major royal jelly protein 9 protein. Length = 423 Score = 21.4 bits (43), Expect = 9.3 Identities = 7/22 (31%), Positives = 13/22 (59%) Frame = -1 Query: 204 NVYTRNNGGFLTLYHKVYKKIS 139 N+Y R N ++ + Y+KI+ Sbjct: 363 NIYERQNNEYIWIVSNKYQKIA 384 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 201,917 Number of Sequences: 438 Number of extensions: 4412 Number of successful extensions: 9 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 9 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 9 length of database: 146,343 effective HSP length: 56 effective length of database: 121,815 effective search space used: 23510295 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -