Bombyx BLAST Result against tribolium

BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= brP-0297
         (800 letters)

Database: tribolium 
           336 sequences; 122,585 total letters

Searching.......................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AF227923-1|AAF36721.1|  351|Tribolium castaneum abdominal-B prot...    23   2.8  
AY295880-2|AAQ62694.1| 1558|Tribolium castaneum chitin synthase ...    22   5.0  
AY295880-1|AAQ62693.1| 1558|Tribolium castaneum chitin synthase ...    22   5.0  
AY291476-1|AAQ55060.1| 1558|Tribolium castaneum chitin synthase ...    22   5.0  
AY291475-1|AAQ55059.1| 1558|Tribolium castaneum chitin synthase ...    22   5.0  
AF225975-1|AAF74117.1|  256|Tribolium castaneum unknown protein.       22   5.0  

>AF227923-1|AAF36721.1|  351|Tribolium castaneum abdominal-B
           protein.
          Length = 351

 Score = 23.0 bits (47), Expect = 2.8
 Identities = 10/21 (47%), Positives = 12/21 (57%), Gaps = 1/21 (4%)
 Frame = +2

Query: 152 GGHAEEHHHVL-RHVAARGGV 211
           G H    HHV+  HVAA G +
Sbjct: 327 GHHIHAQHHVVNHHVAANGSL 347


>AY295880-2|AAQ62694.1| 1558|Tribolium castaneum chitin synthase
           variant 2 protein.
          Length = 1558

 Score = 22.2 bits (45), Expect = 5.0
 Identities = 8/12 (66%), Positives = 9/12 (75%)
 Frame = -3

Query: 660 TLITTHVITPKC 625
           T IT H+ TPKC
Sbjct: 475 TWITLHIWTPKC 486


>AY295880-1|AAQ62693.1| 1558|Tribolium castaneum chitin synthase
           variant 1 protein.
          Length = 1558

 Score = 22.2 bits (45), Expect = 5.0
 Identities = 8/12 (66%), Positives = 9/12 (75%)
 Frame = -3

Query: 660 TLITTHVITPKC 625
           T IT H+ TPKC
Sbjct: 475 TWITLHIWTPKC 486


>AY291476-1|AAQ55060.1| 1558|Tribolium castaneum chitin synthase
           CHS1B protein.
          Length = 1558

 Score = 22.2 bits (45), Expect = 5.0
 Identities = 8/12 (66%), Positives = 9/12 (75%)
 Frame = -3

Query: 660 TLITTHVITPKC 625
           T IT H+ TPKC
Sbjct: 475 TWITLHIWTPKC 486


>AY291475-1|AAQ55059.1| 1558|Tribolium castaneum chitin synthase
           CHS1A protein.
          Length = 1558

 Score = 22.2 bits (45), Expect = 5.0
 Identities = 8/12 (66%), Positives = 9/12 (75%)
 Frame = -3

Query: 660 TLITTHVITPKC 625
           T IT H+ TPKC
Sbjct: 475 TWITLHIWTPKC 486


>AF225975-1|AAF74117.1|  256|Tribolium castaneum unknown protein.
          Length = 256

 Score = 22.2 bits (45), Expect = 5.0
 Identities = 10/30 (33%), Positives = 13/30 (43%)
 Frame = -1

Query: 248 DVPRDLVVGLRRGLHRVPRHVVERDDVLQH 159
           +  RD V G    +  +PRH     D L H
Sbjct: 15  EAARDFVQGYPASVQPLPRHFNPPSDKLHH 44


  Database: tribolium
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 122,585
  Number of sequences in database:  336
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 165,713
Number of Sequences: 336
Number of extensions: 3471
Number of successful extensions: 10
Number of sequences better than 10.0: 6
Number of HSP's better than 10.0 without gapping: 9
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 9
length of database: 122,585
effective HSP length: 56
effective length of database: 103,769
effective search space used: 21791490
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)