BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= brP-0297 (800 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_20291| Best HMM Match : ATP-synt_ab (HMM E-Value=0) 215 3e-56 >SB_20291| Best HMM Match : ATP-synt_ab (HMM E-Value=0) Length = 475 Score = 215 bits (526), Expect = 3e-56 Identities = 97/130 (74%), Positives = 115/130 (88%) Frame = +3 Query: 3 DLSEIVQLVGKASLAETDKITLEVAKLLKDDFLQQNSYSSYDRFCPFYKTVGMLKNIITF 182 DLSEIVQLVGK SLAE+DKITLEVAKL+KDDFLQQN Y+ YD+FCPFYKTVGML NI+ F Sbjct: 346 DLSEIVQLVGKGSLAESDKITLEVAKLIKDDFLQQNGYTPYDKFCPFYKTVGMLSNIVAF 405 Query: 183 YDMSRHAVESTAQSDNKVTWNVIRDAMGNVLYQLSSMKFKDPVKDGEPKIKADFDQLLED 362 YDM+RH+VE+TAQ++NKVTWNVI++ MG+ +Y LSSMKFKDP+KDGE KIKADF +L E Sbjct: 406 YDMARHSVETTAQAENKVTWNVIKENMGDAIYALSSMKFKDPIKDGEAKIKADFAELHEQ 465 Query: 363 MSAAFRNLED 392 + FR+LED Sbjct: 466 LQQGFRSLED 475 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 22,250,897 Number of Sequences: 59808 Number of extensions: 442339 Number of successful extensions: 1293 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 1143 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1285 length of database: 16,821,457 effective HSP length: 81 effective length of database: 11,977,009 effective search space used: 2215746665 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -