BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= brP-0296 (750 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AM422833-1|CAM12801.1| 2139|Anopheles gambiae voltage-gated sodi... 26 1.1 CR954256-5|CAJ14146.1| 615|Anopheles gambiae predicted protein ... 25 2.5 M93691-2|AAA29365.1| 1222|Anopheles gambiae protein ( Anopheles ... 23 7.6 >AM422833-1|CAM12801.1| 2139|Anopheles gambiae voltage-gated sodium channel alpha subunitprotein. Length = 2139 Score = 26.2 bits (55), Expect = 1.1 Identities = 9/22 (40%), Positives = 13/22 (59%) Frame = -2 Query: 389 LPADSGCGSPGNCSRHSLSVQY 324 LP D+ G PGNC ++ + Y Sbjct: 1822 LPPDNDKGYPGNCGSSTIGITY 1843 >CR954256-5|CAJ14146.1| 615|Anopheles gambiae predicted protein protein. Length = 615 Score = 25.0 bits (52), Expect = 2.5 Identities = 20/91 (21%), Positives = 36/91 (39%), Gaps = 1/91 (1%) Frame = +3 Query: 312 SRPIVLHGKRMPRAITRASAAGVGWQQLHHDVRDDGICVSYVYDAPATQPDPRCGQTSAQ 491 +R I L K + TRA+AA V Q H + + + + + + P + + Sbjct: 264 ARIITLTPKNVGSEATRATAAAVASDQAHREAQLRLLADTKKFTRFLVEAPPVASVEAVK 323 Query: 492 SSRPXRCSPYTFXNLINTCRXDLFIPXG-RC 581 + + P ++ L C L + G RC Sbjct: 324 FTHIFQILPPSYDRLCQQCHKALHLDIGLRC 354 >M93691-2|AAA29365.1| 1222|Anopheles gambiae protein ( Anopheles gambiae RT2 retroposon. ). Length = 1222 Score = 23.4 bits (48), Expect = 7.6 Identities = 11/25 (44%), Positives = 12/25 (48%) Frame = +1 Query: 451 RRNQIQDAAKPAHNPHDRXGAPPTP 525 RRN + AA R G PPTP Sbjct: 1110 RRNANRRAATARRREERRAGLPPTP 1134 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 662,916 Number of Sequences: 2352 Number of extensions: 12188 Number of successful extensions: 21 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 21 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 21 length of database: 563,979 effective HSP length: 63 effective length of database: 415,803 effective search space used: 77339358 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -