BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= brP-0296 (750 letters) Database: fruitfly 53,049 sequences; 24,988,368 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY113320-1|AAM29325.1| 110|Drosophila melanogaster AT28250p pro... 54 2e-07 AE013599-3894|AAM68318.1| 110|Drosophila melanogaster CG13585-P... 54 2e-07 AE013599-3893|AAF47223.1| 110|Drosophila melanogaster CG13585-P... 54 2e-07 >AY113320-1|AAM29325.1| 110|Drosophila melanogaster AT28250p protein. Length = 110 Score = 54.0 bits (124), Expect = 2e-07 Identities = 23/52 (44%), Positives = 34/52 (65%), Gaps = 1/52 (1%) Frame = +1 Query: 235 MGDEMDPCECLWNHELAMRRLISLLRQGQSYCTESECLEQLPGLP-QPESAG 387 M D+ D CEC+W+ E AM+RLI+ +RQ Q+ C ++EC + P Q + AG Sbjct: 1 MSDDFDGCECVWSQEYAMQRLINFIRQNQNACGDNECYDVTGRTPHQAQIAG 52 >AE013599-3894|AAM68318.1| 110|Drosophila melanogaster CG13585-PB, isoform B protein. Length = 110 Score = 54.0 bits (124), Expect = 2e-07 Identities = 23/52 (44%), Positives = 34/52 (65%), Gaps = 1/52 (1%) Frame = +1 Query: 235 MGDEMDPCECLWNHELAMRRLISLLRQGQSYCTESECLEQLPGLP-QPESAG 387 M D+ D CEC+W+ E AM+RLI+ +RQ Q+ C ++EC + P Q + AG Sbjct: 1 MSDDFDGCECVWSQEYAMQRLINFIRQNQNACGDNECYDVTGRTPHQAQIAG 52 >AE013599-3893|AAF47223.1| 110|Drosophila melanogaster CG13585-PA, isoform A protein. Length = 110 Score = 54.0 bits (124), Expect = 2e-07 Identities = 23/52 (44%), Positives = 34/52 (65%), Gaps = 1/52 (1%) Frame = +1 Query: 235 MGDEMDPCECLWNHELAMRRLISLLRQGQSYCTESECLEQLPGLP-QPESAG 387 M D+ D CEC+W+ E AM+RLI+ +RQ Q+ C ++EC + P Q + AG Sbjct: 1 MSDDFDGCECVWSQEYAMQRLINFIRQNQNACGDNECYDVTGRTPHQAQIAG 52 Database: fruitfly Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 24,988,368 Number of sequences in database: 53,049 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 27,877,849 Number of Sequences: 53049 Number of extensions: 511125 Number of successful extensions: 1274 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 1239 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1274 length of database: 24,988,368 effective HSP length: 83 effective length of database: 20,585,301 effective search space used: 3417159966 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -