BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= brP-0295 (750 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value EF531707-1|ABP57431.1| 138|Apis mellifera structural cuticle pr... 58 7e-11 AY398690-1|AAR83734.1| 416|Apis mellifera major royal jelly pro... 22 7.1 >EF531707-1|ABP57431.1| 138|Apis mellifera structural cuticle protein protein. Length = 138 Score = 58.4 bits (135), Expect = 7e-11 Identities = 28/81 (34%), Positives = 45/81 (55%) Frame = +2 Query: 74 NGSYKYEYQIADGTHVGEEGYFTNPNTEEASLVKKGWYSYTGADGKVYTVHYWADKTGYH 253 +G+Y ++ ++G E G + E +V +G SYT DG+ ++ Y AD+ G+ Sbjct: 39 DGNYINNFETSNGISHQESGQPKQVDNE-TPVVSQGSDSYTAPDGQQVSITYVADENGFQ 97 Query: 254 AYGDHLPTPPPVPAAIQAALD 316 G H+PT PP+P IQ AL+ Sbjct: 98 VQGSHIPTAPPIPPEIQRALE 118 >AY398690-1|AAR83734.1| 416|Apis mellifera major royal jelly protein 8 protein. Length = 416 Score = 21.8 bits (44), Expect = 7.1 Identities = 11/32 (34%), Positives = 14/32 (43%) Frame = +2 Query: 50 KNEMYYGDNGSYKYEYQIADGTHVGEEGYFTN 145 KNE G +YK E + D V + G N Sbjct: 112 KNENCSGITSAYKIEIDMCDRLWVLDSGLINN 143 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 183,229 Number of Sequences: 438 Number of extensions: 3992 Number of successful extensions: 4 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 4 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 4 length of database: 146,343 effective HSP length: 56 effective length of database: 121,815 effective search space used: 23510295 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -