BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= brP-0294 (750 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At5g59170.1 68418.m07416 proline-rich family protein contains pr... 38 0.009 At2g27380.1 68415.m03302 proline-rich family protein contains pr... 35 0.050 At4g34150.1 68417.m04846 C2 domain-containing protein similar to... 34 0.088 At3g49840.1 68416.m05449 proline-rich family protein contains pr... 34 0.088 At1g12040.1 68414.m01390 leucine-rich repeat family protein / ex... 34 0.088 At1g62440.1 68414.m07044 leucine-rich repeat family protein / ex... 33 0.15 At5g26080.1 68418.m03103 proline-rich family protein contains pr... 32 0.35 At4g23470.2 68417.m03383 hydroxyproline-rich glycoprotein family... 32 0.47 At4g23470.1 68417.m03382 hydroxyproline-rich glycoprotein family... 32 0.47 At1g76930.2 68414.m08956 proline-rich extensin-like family prote... 31 0.62 At1g76930.1 68414.m08955 proline-rich extensin-like family prote... 31 0.62 At1g54170.1 68414.m06175 ataxin-2-related similar to SCA2 (GI:17... 31 0.62 At5g45350.1 68418.m05567 proline-rich family protein contains pr... 31 0.82 At1g31750.1 68414.m03895 proline-rich family protein contains pr... 31 0.82 At4g33970.1 68417.m04820 leucine-rich repeat family protein / ex... 31 1.1 At5g67600.1 68418.m08524 expressed protein 30 1.4 At1g33080.2 68414.m04081 MATE efflux family protein similar to r... 30 1.9 At1g54970.1 68414.m06278 proline-rich family protein similar to ... 29 2.5 At1g47210.2 68414.m05226 cyclin family protein similar to A-type... 29 2.5 At1g22080.1 68414.m02761 hypothetical protein 29 2.5 At5g19810.1 68418.m02354 proline-rich extensin-like family prote... 29 3.3 At3g59690.1 68416.m06660 calmodulin-binding family protein simil... 29 3.3 At3g24550.1 68416.m03083 protein kinase family protein contains ... 29 3.3 At2g20320.1 68415.m02373 DENN (AEX-3) domain-containing protein ... 29 3.3 At4g35800.1 68417.m05087 DNA-directed RNA polymerase II largest ... 29 4.4 At1g67140.1 68414.m07638 expressed protein 29 4.4 At1g49490.1 68414.m05547 leucine-rich repeat family protein / ex... 29 4.4 At1g21670.1 68414.m02712 expressed protein similar to TolB prote... 29 4.4 At1g09070.1 68414.m01012 C2 domain-containing protein / src2-lik... 29 4.4 At5g02880.1 68418.m00231 HECT-domain-containing protein / ubiqui... 28 5.8 At4g21670.1 68417.m03139 double-stranded RNA-binding domain (DsR... 28 5.8 At4g14070.1 68417.m02172 AMP-binding protein, putative similar t... 28 5.8 At4g08380.1 68417.m01384 proline-rich extensin-like family prote... 28 5.8 At5g15140.1 68418.m01774 aldose 1-epimerase family protein simil... 28 7.6 At4g26750.1 68417.m03854 hydroxyproline-rich glycoprotein family... 28 7.6 At3g62200.1 68416.m06988 expressed protein contains Pfam profile... 28 7.6 At3g04980.1 68416.m00541 DNAJ heat shock N-terminal domain-conta... 28 7.6 >At5g59170.1 68418.m07416 proline-rich family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 288 Score = 37.5 bits (83), Expect = 0.009 Identities = 20/51 (39%), Positives = 23/51 (45%), Gaps = 2/51 (3%) Frame = +3 Query: 189 PPIQWKPQNTWNAPPKPIQP-INTYPQ-NNYAPPQNSYYPQNTYAPPQNTY 335 PP Q+ P PP+ P I YP +Y PP Y PQ Y PP Y Sbjct: 129 PPEQYSPPFKKYPPPEQYPPPIKKYPPPEHYPPPIKKYPPQEQYPPPIKKY 179 Score = 36.3 bits (80), Expect = 0.022 Identities = 22/56 (39%), Positives = 27/56 (48%), Gaps = 7/56 (12%) Frame = +3 Query: 189 PPIQWKPQNTWNAPPKPIQPINTYPQN-NYAPPQNSY------YPQNTYAPPQNTY 335 PP +W P+ ++ PPKP PI YP Y PP Y +P Y PP TY Sbjct: 41 PPFKWGPKFPYS-PPKP-PPIEKYPPPVQYPPPIKKYPPPPYEHPPVKYPPPIKTY 94 Score = 36.3 bits (80), Expect = 0.022 Identities = 20/51 (39%), Positives = 22/51 (43%), Gaps = 2/51 (3%) Frame = +3 Query: 189 PPIQWKPQNTWNAPPKPIQP-INTYP-QNNYAPPQNSYYPQNTYAPPQNTY 335 PP Q+ P PP+ P I YP Q Y PP Y P Y PP Y Sbjct: 142 PPEQYPPPIKKYPPPEHYPPPIKKYPPQEQYPPPIKKYPPPEKYPPPIKKY 192 Score = 35.1 bits (77), Expect = 0.050 Identities = 19/51 (37%), Positives = 22/51 (43%), Gaps = 2/51 (3%) Frame = +3 Query: 189 PPIQWKPQNTWNAPPKPIQP-INTY-PQNNYAPPQNSYYPQNTYAPPQNTY 335 PP Q+ P PP+ P I Y P Y+PP Y P Y PP Y Sbjct: 103 PPEQYPPPIKKYPPPEQYPPPIKKYPPPEQYSPPFKKYPPPEQYPPPIKKY 153 Score = 35.1 bits (77), Expect = 0.050 Identities = 19/52 (36%), Positives = 22/52 (42%), Gaps = 3/52 (5%) Frame = +3 Query: 189 PPIQ-WKPQNTWNAPPKPIQPINTYPQ--NNYAPPQNSYYPQNTYAPPQNTY 335 PPI+ + P + P K P YP Y PP Y P Y PP TY Sbjct: 174 PPIKKYPPPEKYPPPIKKYPPPEQYPPPIKKYPPPIKKYPPPEEYPPPIKTY 225 Score = 33.9 bits (74), Expect = 0.12 Identities = 21/53 (39%), Positives = 23/53 (43%), Gaps = 4/53 (7%) Frame = +3 Query: 189 PPIQWKPQNTWNAPPKPIQ---PINTYPQ-NNYAPPQNSYYPQNTYAPPQNTY 335 PPI+ P PP P Q PI YP Y PP Y P Y+PP Y Sbjct: 89 PPIKTYPHPPVKYPP-PEQYPPPIKKYPPPEQYPPPIKKYPPPEQYSPPFKKY 140 Score = 33.1 bits (72), Expect = 0.20 Identities = 21/58 (36%), Positives = 23/58 (39%), Gaps = 9/58 (15%) Frame = +3 Query: 189 PPIQWKPQNTWNAPP-KPIQPINTYPQ--------NNYAPPQNSYYPQNTYAPPQNTY 335 PPI+ P + PP K PI TYP Y PP Y P Y PP Y Sbjct: 70 PPIKKYPPPPYEHPPVKYPPPIKTYPHPPVKYPPPEQYPPPIKKYPPPEQYPPPIKKY 127 Score = 33.1 bits (72), Expect = 0.20 Identities = 15/48 (31%), Positives = 21/48 (43%), Gaps = 2/48 (4%) Frame = +3 Query: 189 PPIQWKPQNTWNAPPKPIQPINTYPQ--NNYAPPQNSYYPQNTYAPPQ 326 PP+++ P + P K P YP Y PP+ P Y PP+ Sbjct: 97 PPVKYPPPEQYPPPIKKYPPPEQYPPPIKKYPPPEQYSPPFKKYPPPE 144 Score = 31.5 bits (68), Expect = 0.62 Identities = 18/52 (34%), Positives = 22/52 (42%), Gaps = 3/52 (5%) Frame = +3 Query: 189 PPIQ-WKPQNTWNAPPKPIQPINTYPQ--NNYAPPQNSYYPQNTYAPPQNTY 335 PPI+ + PQ + P K P YP Y PP+ P Y PP Y Sbjct: 161 PPIKKYPPQEQYPPPIKKYPPPEKYPPPIKKYPPPEQYPPPIKKYPPPIKKY 212 Score = 29.5 bits (63), Expect = 2.5 Identities = 16/50 (32%), Positives = 20/50 (40%), Gaps = 1/50 (2%) Frame = +3 Query: 189 PPIQWKPQNTWNAPPKPIQPINTYPQNNYAPPQNSYYPQNTYA-PPQNTY 335 PPI+ P PP P + P Y PP+ P Y PP+ Y Sbjct: 220 PPIKTYPHPPVKYPPPPYKTYPHPPIKTYPPPKECPPPPEHYPWPPKKKY 269 Score = 28.7 bits (61), Expect = 4.4 Identities = 15/46 (32%), Positives = 18/46 (39%), Gaps = 1/46 (2%) Frame = +3 Query: 189 PPIQWKPQNTWNAPPKPIQP-INTYPQNNYAPPQNSYYPQNTYAPP 323 PP Q+ P PP+ P YP PP YP + PP Sbjct: 116 PPEQYPPPIKKYPPPEQYSPPFKKYPPPEQYPPPIKKYPPPEHYPP 161 Score = 28.7 bits (61), Expect = 4.4 Identities = 12/41 (29%), Positives = 18/41 (43%) Frame = +2 Query: 167 VRTFEPEPAYPVETSKYVERSTQADPADKHLSPKQLRPPSK 289 ++ + P+ YP KY P K+ P+Q PP K Sbjct: 163 IKKYPPQEQYPPPIKKYPPPEKYPPPIKKYPPPEQYPPPIK 203 Score = 27.9 bits (59), Expect = 7.6 Identities = 12/41 (29%), Positives = 18/41 (43%) Frame = +2 Query: 167 VRTFEPEPAYPVETSKYVERSTQADPADKHLSPKQLRPPSK 289 ++ + P YP KY + P K+ P+Q PP K Sbjct: 111 IKKYPPPEQYPPPIKKYPPPEQYSPPFKKYPPPEQYPPPIK 151 Score = 27.9 bits (59), Expect = 7.6 Identities = 19/49 (38%), Positives = 22/49 (44%), Gaps = 4/49 (8%) Frame = +3 Query: 189 PPIQWKPQNTWNAPP--KPIQPINTYPQN-NYAPPQNSY-YPQNTYAPP 323 PPI+ P PP K PI YP Y PP +Y +P Y PP Sbjct: 187 PPIKKYPPPEQYPPPIKKYPPPIKKYPPPEEYPPPIKTYPHPPVKYPPP 235 >At2g27380.1 68415.m03302 proline-rich family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 761 Score = 35.1 bits (77), Expect = 0.050 Identities = 18/49 (36%), Positives = 23/49 (46%) Frame = +3 Query: 189 PPIQWKPQNTWNAPPKPIQPINTYPQNNYAPPQNSYYPQNTYAPPQNTY 335 PP+Q P T++ P KP P+ P Y+PP P PP TY Sbjct: 675 PPVQLPPTPTYSPPVKP-PPVQVPPTPTYSPPVK---PPPVQVPPTPTY 719 Score = 34.3 bits (75), Expect = 0.088 Identities = 20/49 (40%), Positives = 23/49 (46%) Frame = +3 Query: 189 PPIQWKPQNTWNAPPKPIQPINTYPQNNYAPPQNSYYPQNTYAPPQNTY 335 PPIQ P T++ P P PI P Y+PP YP PP TY Sbjct: 85 PPIQKPPTPTYSPPIYP-PPIQKPPTPTYSPP---IYPPPIQKPPTPTY 129 Score = 34.3 bits (75), Expect = 0.088 Identities = 18/49 (36%), Positives = 23/49 (46%) Frame = +3 Query: 189 PPIQWKPQNTWNAPPKPIQPINTYPQNNYAPPQNSYYPQNTYAPPQNTY 335 PP+Q P T++ P KP P+ P Y+PP P PP TY Sbjct: 658 PPVQKPPTPTYSPPVKP-PPVQLPPTPTYSPPVK---PPPVQVPPTPTY 702 Score = 33.9 bits (74), Expect = 0.12 Identities = 19/48 (39%), Positives = 24/48 (50%), Gaps = 3/48 (6%) Frame = +3 Query: 189 PPIQWKPQNTWNAPPKPIQPINTYPQNNYAPPQNS---YYPQNTYAPP 323 PP+Q P T++ P KP PI P Y+PP P TY+PP Sbjct: 489 PPVQKPPTPTYSPPVKP-PPIQKPPTPTYSPPIKPPPVKPPTPTYSPP 535 Score = 33.5 bits (73), Expect = 0.15 Identities = 18/49 (36%), Positives = 25/49 (51%), Gaps = 4/49 (8%) Frame = +3 Query: 189 PPIQWKPQNTWNAPPKPIQPINTYPQNNYAPPQNS----YYPQNTYAPP 323 PP+Q P ++ P KP P++ P Y+PP S P TY+PP Sbjct: 271 PPVQTPPTPIYSPPVKP-PPVHKPPTPTYSPPVKSPPVQKPPTPTYSPP 318 Score = 33.1 bits (72), Expect = 0.20 Identities = 18/49 (36%), Positives = 24/49 (48%) Frame = +3 Query: 189 PPIQWKPQNTWNAPPKPIQPINTYPQNNYAPPQNSYYPQNTYAPPQNTY 335 PP+ P T++ P KP PI+ P Y+PP P + PP TY Sbjct: 539 PPVHKPPTPTYSPPIKP-PPIHKPPTPTYSPP---IKPPPVHKPPTPTY 583 Score = 33.1 bits (72), Expect = 0.20 Identities = 18/49 (36%), Positives = 24/49 (48%) Frame = +3 Query: 189 PPIQWKPQNTWNAPPKPIQPINTYPQNNYAPPQNSYYPQNTYAPPQNTY 335 PPI P T++ P KP P++ P Y+PP P + PP TY Sbjct: 556 PPIHKPPTPTYSPPIKP-PPVHKPPTPTYSPP---IKPPPVHKPPTPTY 600 Score = 32.7 bits (71), Expect = 0.27 Identities = 19/49 (38%), Positives = 23/49 (46%) Frame = +3 Query: 189 PPIQWKPQNTWNAPPKPIQPINTYPQNNYAPPQNSYYPQNTYAPPQNTY 335 PPIQ P T++ P P PI P Y+PP YP PP +Y Sbjct: 102 PPIQKPPTPTYSPPIYP-PPIQKPPTPTYSPP---IYPPPIQKPPTPSY 146 Score = 32.7 bits (71), Expect = 0.27 Identities = 17/49 (34%), Positives = 24/49 (48%) Frame = +3 Query: 189 PPIQWKPQNTWNAPPKPIQPINTYPQNNYAPPQNSYYPQNTYAPPQNTY 335 PP+ P T++ P KP P++ P Y+PP P + PP TY Sbjct: 573 PPVHKPPTPTYSPPIKP-PPVHKPPTPTYSPP---IKPPPVHKPPTPTY 617 Score = 32.7 bits (71), Expect = 0.27 Identities = 17/49 (34%), Positives = 24/49 (48%) Frame = +3 Query: 189 PPIQWKPQNTWNAPPKPIQPINTYPQNNYAPPQNSYYPQNTYAPPQNTY 335 PP+ P T++ P KP P++ P Y+PP P + PP TY Sbjct: 590 PPVHKPPTPTYSPPIKP-PPVHKPPTPTYSPP---IKPPPVHKPPTPTY 634 Score = 32.7 bits (71), Expect = 0.27 Identities = 17/49 (34%), Positives = 24/49 (48%) Frame = +3 Query: 189 PPIQWKPQNTWNAPPKPIQPINTYPQNNYAPPQNSYYPQNTYAPPQNTY 335 PP+ P T++ P KP P++ P Y+PP P + PP TY Sbjct: 607 PPVHKPPTPTYSPPIKP-PPVHKPPTPTYSPP---IKPPPVHKPPTPTY 651 Score = 32.3 bits (70), Expect = 0.35 Identities = 17/48 (35%), Positives = 24/48 (50%), Gaps = 3/48 (6%) Frame = +3 Query: 189 PPIQWKPQNTWNAPPKPIQPINTYPQNNYAPPQNSYY---PQNTYAPP 323 PP+Q P T++ P KP P++ P Y+PP P Y+PP Sbjct: 153 PPVQMPPTPTYSPPIKP-PPVHKPPTPTYSPPIKPPVHKPPTPIYSPP 199 Score = 31.9 bits (69), Expect = 0.47 Identities = 19/49 (38%), Positives = 24/49 (48%), Gaps = 4/49 (8%) Frame = +3 Query: 189 PPIQWKPQNTWNAPPKPIQPINTYPQNNYAPPQN----SYYPQNTYAPP 323 PPIQ P T++ P P PI P +Y+PP P TY+PP Sbjct: 119 PPIQKPPTPTYSPPIYP-PPIQKPPTPSYSPPVKPPPVQMPPTPTYSPP 166 Score = 31.9 bits (69), Expect = 0.47 Identities = 17/49 (34%), Positives = 23/49 (46%) Frame = +3 Query: 189 PPIQWKPQNTWNAPPKPIQPINTYPQNNYAPPQNSYYPQNTYAPPQNTY 335 PP+ P ++ P KP P+ T P Y+PP P + PP TY Sbjct: 254 PPVHKPPTPIYSPPVKP-PPVQTPPTPIYSPPVK---PPPVHKPPTPTY 298 Score = 31.5 bits (68), Expect = 0.62 Identities = 17/47 (36%), Positives = 22/47 (46%), Gaps = 2/47 (4%) Frame = +3 Query: 189 PPIQWKPQNTWNAP--PKPIQPINTYPQNNYAPPQNSYYPQNTYAPP 323 PPIQ P T++ P P P++P PP P TY+PP Sbjct: 506 PPIQKPPTPTYSPPIKPPPVKPPTPTYSPPIKPPPVHKPPTPTYSPP 552 Score = 31.5 bits (68), Expect = 0.62 Identities = 17/49 (34%), Positives = 23/49 (46%) Frame = +3 Query: 189 PPIQWKPQNTWNAPPKPIQPINTYPQNNYAPPQNSYYPQNTYAPPQNTY 335 PP+ P T++ P KP P++ P Y+PP P PP TY Sbjct: 624 PPVHKPPTPTYSPPIKP-PPVHKPPTPTYSPP---IKPPPVQKPPTPTY 668 Score = 31.5 bits (68), Expect = 0.62 Identities = 17/49 (34%), Positives = 23/49 (46%), Gaps = 4/49 (8%) Frame = +3 Query: 189 PPIQWKPQNTWNAPPKPIQPINTYPQNNYAPPQN----SYYPQNTYAPP 323 PP+ P T++ P KP P+ P Y+PP P TY+PP Sbjct: 641 PPVHKPPTPTYSPPIKP-PPVQKPPTPTYSPPVKPPPVQLPPTPTYSPP 688 Score = 31.5 bits (68), Expect = 0.62 Identities = 17/48 (35%), Positives = 22/48 (45%) Frame = +3 Query: 189 PPIQWKPQNTWNAPPKPIQPINTYPQNNYAPPQNSYYPQNTYAPPQNT 332 PP+Q P T++ P KP P+ P Y+PP P PP T Sbjct: 692 PPVQVPPTPTYSPPVKP-PPVQVPPTPTYSPP---IKPPPVQVPPTPT 735 Score = 30.7 bits (66), Expect = 1.1 Identities = 19/51 (37%), Positives = 21/51 (41%), Gaps = 2/51 (3%) Frame = +3 Query: 189 PPIQWKPQNTWNAPPKPIQPINTYPQNNYAPPQNS--YYPQNTYAPPQNTY 335 PPI P + + PP PI YP PP S YP PP TY Sbjct: 46 PPIYGAPPS-YTTPPPPIYSPPIYPPPIQKPPTYSPPIYPPPIQKPPTPTY 95 Score = 30.7 bits (66), Expect = 1.1 Identities = 17/48 (35%), Positives = 23/48 (47%), Gaps = 3/48 (6%) Frame = +3 Query: 189 PPIQWKPQNTWNAPPKPIQPINTYPQNNYAPPQNS---YYPQNTYAPP 323 PP+Q P T++ P KP P+ P Y+PP P Y+PP Sbjct: 305 PPVQKPPTPTYSPPIKP-PPVQKPPTPTYSPPIKPPPVKPPTPIYSPP 351 Score = 29.5 bits (63), Expect = 2.5 Identities = 16/49 (32%), Positives = 23/49 (46%) Frame = +3 Query: 189 PPIQWKPQNTWNAPPKPIQPINTYPQNNYAPPQNSYYPQNTYAPPQNTY 335 PP+ P T++ P KP P++ P Y+PP P + PP Y Sbjct: 220 PPVHKPPTPTYSPPVKP-PPVHKPPTPIYSPP---IKPPPVHKPPTPIY 264 Score = 29.5 bits (63), Expect = 2.5 Identities = 16/48 (33%), Positives = 23/48 (47%), Gaps = 3/48 (6%) Frame = +3 Query: 189 PPIQWKPQNTWNAPPKPIQPINTYPQNNYAPPQNS---YYPQNTYAPP 323 PP+ P ++ P KP P++ P Y+PP P TY+PP Sbjct: 439 PPVHKPPTPIYSPPVKP-PPVHKPPTPTYSPPIKPPPVKPPTPTYSPP 485 Score = 29.5 bits (63), Expect = 2.5 Identities = 15/47 (31%), Positives = 21/47 (44%), Gaps = 2/47 (4%) Frame = +3 Query: 189 PPIQWKPQNTWNAP--PKPIQPINTYPQNNYAPPQNSYYPQNTYAPP 323 PP+ P T++ P P P++P PP P TY+PP Sbjct: 456 PPVHKPPTPTYSPPIKPPPVKPPTPTYSPPVQPPPVQKPPTPTYSPP 502 Score = 29.5 bits (63), Expect = 2.5 Identities = 17/49 (34%), Positives = 25/49 (51%) Frame = +3 Query: 189 PPIQWKPQNTWNAPPKPIQPINTYPQNNYAPPQNSYYPQNTYAPPQNTY 335 PP++ P T++ P KP P++ P Y+PP P + PP TY Sbjct: 523 PPVK-PPTPTYSPPIKP-PPVHKPPTPTYSPP---IKPPPIHKPPTPTY 566 Score = 29.1 bits (62), Expect = 3.3 Identities = 16/49 (32%), Positives = 23/49 (46%) Frame = +3 Query: 189 PPIQWKPQNTWNAPPKPIQPINTYPQNNYAPPQNSYYPQNTYAPPQNTY 335 PP+ P ++ P KP P++ P Y+PP P + PP TY Sbjct: 186 PPVHKPPTPIYSPPIKP-PPVHKPPTPIYSPP---IKPPPVHKPPTPTY 230 Score = 29.1 bits (62), Expect = 3.3 Identities = 17/49 (34%), Positives = 22/49 (44%), Gaps = 4/49 (8%) Frame = +3 Query: 189 PPIQWKPQNTWNAPPKPIQPINTYPQNNYAPPQN----SYYPQNTYAPP 323 PP+ P ++ P KP PI P Y+PP P TY+PP Sbjct: 372 PPVHKPPTPIYSPPVKP-PPIQKPPTPTYSPPIKPPPLQKPPTPTYSPP 419 Score = 28.7 bits (61), Expect = 4.4 Identities = 16/49 (32%), Positives = 21/49 (42%) Frame = +3 Query: 189 PPIQWKPQNTWNAPPKPIQPINTYPQNNYAPPQNSYYPQNTYAPPQNTY 335 PP+ P T++ PP P+ P Y+PP P PP TY Sbjct: 288 PPVHKPPTPTYS-PPVKSPPVQKPPTPTYSPP---IKPPPVQKPPTPTY 332 Score = 28.3 bits (60), Expect = 5.8 Identities = 15/49 (30%), Positives = 22/49 (44%) Frame = +3 Query: 189 PPIQWKPQNTWNAPPKPIQPINTYPQNNYAPPQNSYYPQNTYAPPQNTY 335 PP+ P ++ P KP P++ P Y+PP P + PP Y Sbjct: 203 PPVHKPPTPIYSPPIKP-PPVHKPPTPTYSPPVK---PPPVHKPPTPIY 247 Score = 28.3 bits (60), Expect = 5.8 Identities = 16/49 (32%), Positives = 23/49 (46%), Gaps = 4/49 (8%) Frame = +3 Query: 189 PPIQWKPQNTWNAPPKPIQPINTYPQNNYAPPQN----SYYPQNTYAPP 323 PP+ P ++ P KP P++ P Y+PP P TY+PP Sbjct: 355 PPVHKPPTPIYSPPVKP-PPVHKPPTPIYSPPVKPPPIQKPPTPTYSPP 402 >At4g34150.1 68417.m04846 C2 domain-containing protein similar to calcium-dependent protein kinase [Dunaliella tertiolecta] GI:6644464; contains Pfam profile PF00168: C2 domain Length = 247 Score = 34.3 bits (75), Expect = 0.088 Identities = 19/46 (41%), Positives = 22/46 (47%), Gaps = 5/46 (10%) Frame = +3 Query: 192 PIQWKPQNTWNAPP-----KPIQPINTYPQNNYAPPQNSYYPQNTY 314 P + P +T PP P P + YP Y PPQ SYYPQ Y Sbjct: 194 PSAYPPPSTSGYPPIPSAYPPPPPSSAYPPQPY-PPQPSYYPQGPY 238 Score = 28.3 bits (60), Expect = 5.8 Identities = 12/34 (35%), Positives = 17/34 (50%) Frame = +3 Query: 231 PKPIQPINTYPQNNYAPPQNSYYPQNTYAPPQNT 332 P + YPQ + PP + Y PQ + PP +T Sbjct: 169 PSLYPQVQQYPQPSGYPPASGYPPQPSAYPPPST 202 >At3g49840.1 68416.m05449 proline-rich family protein contains proline rich extensin domains, INTERPRO:IPR002965 Length = 606 Score = 34.3 bits (75), Expect = 0.088 Identities = 20/52 (38%), Positives = 22/52 (42%), Gaps = 6/52 (11%) Frame = +3 Query: 189 PPIQWKPQNTWNAP---PKPIQPINTYPQNNYAPPQNSY---YPQNTYAPPQ 326 PP + P + P P P P YP Y PPQ Y YP Y PPQ Sbjct: 501 PPKEGYPPAGYPPPAGYPPPQYPQAGYPPAGYPPPQQGYGQGYPAQGYPPPQ 552 >At1g12040.1 68414.m01390 leucine-rich repeat family protein / extensin family protein (LRX1) similar to extensin-like protein [Lycopersicon esculentum] gi|5917664|gb|AAD55979; contains leucine-rich repeats, Pfam:PF00560; contains proline rich extensin domains, INTERPRO:IPR002965 Length = 744 Score = 34.3 bits (75), Expect = 0.088 Identities = 18/46 (39%), Positives = 23/46 (50%), Gaps = 2/46 (4%) Frame = +3 Query: 192 PIQWKPQNTWNAPPKPIQPINTYPQNNYAPPQNS--YYPQNTYAPP 323 P+ + P PP P+ YP Y+PP S YYPQ T +PP Sbjct: 572 PVYYPPVTNSPPPPSPVY----YPPVTYSPPPPSPVYYPQVTPSPP 613 Score = 32.7 bits (71), Expect = 0.27 Identities = 17/46 (36%), Positives = 22/46 (47%), Gaps = 2/46 (4%) Frame = +3 Query: 192 PIQWKPQNTWNAPPKPIQPINTYPQ--NNYAPPQNSYYPQNTYAPP 323 P+ + P PP P+ YP N+ PP YYP TY+PP Sbjct: 557 PVYYPPVTQSPPPPSPVY----YPPVTNSPPPPSPVYYPPVTYSPP 598 Score = 30.7 bits (66), Expect = 1.1 Identities = 17/49 (34%), Positives = 22/49 (44%), Gaps = 2/49 (4%) Frame = +3 Query: 192 PIQWKPQNTWNAPPKPIQPINTYPQNNYAPPQNS--YYPQNTYAPPQNT 332 P+ + P PP P+ YP +PP S YYP T +PP T Sbjct: 632 PVYYPPVTPSPPPPSPVY----YPPVTPSPPPPSPVYYPSETQSPPPPT 676 Score = 29.5 bits (63), Expect = 2.5 Identities = 17/46 (36%), Positives = 22/46 (47%), Gaps = 2/46 (4%) Frame = +3 Query: 192 PIQWKPQNTWNAPPKPIQPINTYPQNNYAPPQNS--YYPQNTYAPP 323 P+ + P PP P+ YPQ +PP S YYP T +PP Sbjct: 587 PVYYPPVTYSPPPPSPVY----YPQVTPSPPPPSPLYYPPVTPSPP 628 >At1g62440.1 68414.m07044 leucine-rich repeat family protein / extensin family protein similar to extensin-like protein [Lycopersicon esculentum] gi|5917664|gb|AAD55979; contains leucine-rich repeats, Pfam:PF00560; contains proline rich extensin domains, INTERPRO:IPR002965 Length = 826 Score = 33.5 bits (73), Expect = 0.15 Identities = 17/45 (37%), Positives = 22/45 (48%) Frame = +3 Query: 189 PPIQWKPQNTWNAPPKPIQPINTYPQNNYAPPQNSYYPQNTYAPP 323 PP+ + P T + PP P P+ P PP YYP T +PP Sbjct: 664 PPVYYSPV-TQSPPPPP--PVYYPPVTQSPPPSPVYYPPVTQSPP 705 Score = 30.3 bits (65), Expect = 1.4 Identities = 17/47 (36%), Positives = 22/47 (46%), Gaps = 2/47 (4%) Frame = +3 Query: 189 PPIQWKPQNTWNAPPKPIQPINTYPQNNYAPPQNS--YYPQNTYAPP 323 PP+ + P PP P+ YP +PP S YYP T +PP Sbjct: 707 PPVYYLPVTQSPPPPSPVY----YPPVAKSPPPPSPVYYPPVTQSPP 749 Score = 28.7 bits (61), Expect = 4.4 Identities = 15/49 (30%), Positives = 19/49 (38%) Frame = +3 Query: 189 PPIQWKPQNTWNAPPKPIQPINTYPQNNYAPPQNSYYPQNTYAPPQNTY 335 PP+ P T +PP P P+ Y P YY + PP Y Sbjct: 566 PPVVNCPPTT-QSPPPPKYEQTPSPREYYPSPSPPYYQYTSSPPPPTYY 613 >At5g26080.1 68418.m03103 proline-rich family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 141 Score = 32.3 bits (70), Expect = 0.35 Identities = 17/44 (38%), Positives = 22/44 (50%) Frame = +3 Query: 192 PIQWKPQNTWNAPPKPIQPINTYPQNNYAPPQNSYYPQNTYAPP 323 P+ + P +PP P PI YP Y+PP YP Y+PP Sbjct: 63 PVAFPPPPPIYSPPPP--PI--YPPPIYSPPPPPIYPPPIYSPP 102 >At4g23470.2 68417.m03383 hydroxyproline-rich glycoprotein family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 199 Score = 31.9 bits (69), Expect = 0.47 Identities = 18/47 (38%), Positives = 23/47 (48%), Gaps = 2/47 (4%) Frame = +3 Query: 189 PPIQWKPQNTWNAPPKPIQPINTYPQNNYAPPQNSY--YPQNTYAPP 323 PP Q P + + P P + YPQN PP ++Y YP Y PP Sbjct: 151 PPQQGYPPSGYPQHPPQGYPPSGYPQN---PPPSAYSQYPPGAYPPP 194 >At4g23470.1 68417.m03382 hydroxyproline-rich glycoprotein family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 255 Score = 31.9 bits (69), Expect = 0.47 Identities = 18/47 (38%), Positives = 23/47 (48%), Gaps = 2/47 (4%) Frame = +3 Query: 189 PPIQWKPQNTWNAPPKPIQPINTYPQNNYAPPQNSY--YPQNTYAPP 323 PP Q P + + P P + YPQN PP ++Y YP Y PP Sbjct: 207 PPQQGYPPSGYPQHPPQGYPPSGYPQN---PPPSAYSQYPPGAYPPP 250 >At1g76930.2 68414.m08956 proline-rich extensin-like family protein contains extensin-like region, Pfam:PF04554 Length = 256 Score = 31.5 bits (68), Expect = 0.62 Identities = 16/53 (30%), Positives = 26/53 (49%), Gaps = 3/53 (5%) Frame = +3 Query: 189 PPIQ-WKPQNTWNAPPKPIQPINTYPQNNYAPPQNSYY-PQNTY-APPQNTYR 338 PP++ + P + +PP P++ + P PP YY P Y +PP Y+ Sbjct: 48 PPVKHYSPPPVYKSPPPPVKHYSPPPVYKSPPPPVKYYSPPPVYKSPPPPVYK 100 Score = 29.1 bits (62), Expect = 3.3 Identities = 14/49 (28%), Positives = 25/49 (51%), Gaps = 4/49 (8%) Frame = +3 Query: 189 PPIQW-KPQNTWNAPPKPIQPINTYPQNNYAPP---QNSYYPQNTYAPP 323 PP+++ P + +PP P+ P +Y+PP ++ P Y+PP Sbjct: 80 PPVKYYSPPPVYKSPPPPVYKSPPPPVKHYSPPPVYKSPPPPVKHYSPP 128 >At1g76930.1 68414.m08955 proline-rich extensin-like family protein contains extensin-like region, Pfam:PF04554 Length = 293 Score = 31.5 bits (68), Expect = 0.62 Identities = 16/53 (30%), Positives = 26/53 (49%), Gaps = 3/53 (5%) Frame = +3 Query: 189 PPIQ-WKPQNTWNAPPKPIQPINTYPQNNYAPPQNSYY-PQNTY-APPQNTYR 338 PP++ + P + +PP P++ + P PP YY P Y +PP Y+ Sbjct: 48 PPVKHYSPPPVYKSPPPPVKHYSPPPVYKSPPPPVKYYSPPPVYKSPPPPVYK 100 Score = 29.1 bits (62), Expect = 3.3 Identities = 14/49 (28%), Positives = 25/49 (51%), Gaps = 4/49 (8%) Frame = +3 Query: 189 PPIQW-KPQNTWNAPPKPIQPINTYPQNNYAPP---QNSYYPQNTYAPP 323 PP+++ P + +PP P+ P +Y+PP ++ P Y+PP Sbjct: 80 PPVKYYSPPPVYKSPPPPVYKSPPPPVKHYSPPPVYKSPPPPVKHYSPP 128 >At1g54170.1 68414.m06175 ataxin-2-related similar to SCA2 (GI:1770390) [Homo sapiens]; similar to ataxin-2 (GI:3005020) [Mus musculus] Length = 587 Score = 31.5 bits (68), Expect = 0.62 Identities = 17/57 (29%), Positives = 26/57 (45%) Frame = -1 Query: 366 SDMKACSRWDDMCFEEEHMYSEDSMSFEGGRNCFGDKCLSAGSAWVERSTYFEVSTG 196 S + A +R+DD C+E++ ED + FGD S G ++E S G Sbjct: 271 SSVCATNRFDDTCYEDDEEEEEDILLDCCNNLTFGDSSASDGKEPASTGKFYEDSWG 327 >At5g45350.1 68418.m05567 proline-rich family protein contains proline rich extensin domains, INTERPRO:IPR002965 Length = 177 Score = 31.1 bits (67), Expect = 0.82 Identities = 15/40 (37%), Positives = 16/40 (40%), Gaps = 4/40 (10%) Frame = +3 Query: 228 PPKPIQPINTYPQNNYAPPQNSY----YPQNTYAPPQNTY 335 PP P YPQ Y PP +Y YP Y P Y Sbjct: 22 PPPGAYPPAGYPQQGYPPPPGAYPPAGYPPGAYPPAPGGY 61 >At1g31750.1 68414.m03895 proline-rich family protein contains proline rich extensin domains, INTERPRO:IPR002965 Length = 176 Score = 31.1 bits (67), Expect = 0.82 Identities = 15/44 (34%), Positives = 18/44 (40%), Gaps = 1/44 (2%) Frame = +3 Query: 207 PQNTWNAPPK-PIQPINTYPQNNYAPPQNSYYPQNTYAPPQNTY 335 P + PP+ P YP Y PP + YP Y PP Y Sbjct: 25 PPGAYPPPPQGAYPPPGGYPPQGYPPPPHG-YPPAAYPPPPGAY 67 >At4g33970.1 68417.m04820 leucine-rich repeat family protein / extensin family protein similar to extensin-like protein [Lycopersicon esculentum] gi|5917664|gb|AAD55979; contains leucine-rich repeats, Pfam:PF00560; contains proline rich extensin domains, INTERPRO:IPR002965 Length = 699 Score = 30.7 bits (66), Expect = 1.1 Identities = 14/46 (30%), Positives = 23/46 (50%), Gaps = 1/46 (2%) Frame = +3 Query: 189 PPIQWKPQNTWNAPPKPIQPINTYPQNNYAPPQNSYY-PQNTYAPP 323 PP+ P +PP P P+++ P ++PP Y P ++PP Sbjct: 545 PPVHSPPPPPVYSPPPPPPPVHSPPPPVFSPPPPVYSPPPPVHSPP 590 >At5g67600.1 68418.m08524 expressed protein Length = 82 Score = 30.3 bits (65), Expect = 1.4 Identities = 15/34 (44%), Positives = 16/34 (47%), Gaps = 1/34 (2%) Frame = +3 Query: 228 PPKPIQPINTYPQNNYAPPQNSY-YPQNTYAPPQ 326 PPK P YP Y PP + YP Y PPQ Sbjct: 18 PPKDGYPPAGYPPAGYPPPGYAQGYPAQGYPPPQ 51 >At1g33080.2 68414.m04081 MATE efflux family protein similar to ripening regulated protein DDTFR18 [Lycopersicon esculentum] GI:12231296; contains Pfam profile PF01554: Uncharacterized membrane protein family Length = 490 Score = 29.9 bits (64), Expect = 1.9 Identities = 24/94 (25%), Positives = 44/94 (46%), Gaps = 8/94 (8%) Frame = -2 Query: 617 MVPVSMVASLVGPVVDGVNFAISSSVRVPALFHQACLFCVGIREVAFLAYVCS------- 459 ++ S++ + + PV+ GV V + + AC + VGI FL YV Sbjct: 384 LLAFSILLNSIQPVLSGVAVGAGWQKYVTVV-NLACYYLVGIPSGLFLGYVVGLQVKGVW 442 Query: 458 IGDLVLVFV-TAIITIIHFVLDHWNGSCCSRSLI 360 +G + +FV T ++T++ D W+ C ++I Sbjct: 443 LGMIFGIFVQTCVLTVMTMRTD-WDQQVCKSNII 475 >At1g54970.1 68414.m06278 proline-rich family protein similar to proline-rich protein GI:170048 from [Glycine max] Length = 335 Score = 29.5 bits (63), Expect = 2.5 Identities = 17/50 (34%), Positives = 26/50 (52%), Gaps = 1/50 (2%) Frame = +3 Query: 189 PPIQWKPQNTWNAPPKPIQPINTYPQN-NYAPPQNSYYPQNTYAPPQNTY 335 PP+ +KP + KP P Y ++ +Y+PP + P+ TY PP Y Sbjct: 159 PPV-YKPTLSPPVYTKPTLPPPVYKKSPSYSPPP-PFAPKPTYTPPTKPY 206 >At1g47210.2 68414.m05226 cyclin family protein similar to A-type cyclin [Catharanthus roseus] GI:2190259; contains Pfam profile PF00134: Cyclin, N-terminal domain Length = 372 Score = 29.5 bits (63), Expect = 2.5 Identities = 10/21 (47%), Positives = 14/21 (66%) Frame = -1 Query: 555 HQLQCKSTSPFSPGLPLLCWD 493 H+ QC +T P SP LP+ W+ Sbjct: 348 HKFQCVATMPVSPELPVTFWE 368 >At1g22080.1 68414.m02761 hypothetical protein Length = 475 Score = 29.5 bits (63), Expect = 2.5 Identities = 13/40 (32%), Positives = 22/40 (55%) Frame = +1 Query: 451 SPMEHT*ARKATSRIPTQKRQAW*KRAGTLTLELMAKFTP 570 S MEH+ AR + +++PT W + T+ L+A+ P Sbjct: 412 SKMEHSDARYSVTKVPTSMDTLWAQVIATMPYHLVAQAVP 451 >At5g19810.1 68418.m02354 proline-rich extensin-like family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 249 Score = 29.1 bits (62), Expect = 3.3 Identities = 14/45 (31%), Positives = 21/45 (46%) Frame = +3 Query: 189 PPIQWKPQNTWNAPPKPIQPINTYPQNNYAPPQNSYYPQNTYAPP 323 PP +K + PP P Q +Y ++ PP + Y Y+PP Sbjct: 195 PPPPYKYGRVYPPPPPPPQAARSYKRSPPPPPPSKY--GRVYSPP 237 >At3g59690.1 68416.m06660 calmodulin-binding family protein similar to SF16 protein [Helianthus annuus] GI:560150; contains Pfam profile PF00612: IQ calmodulin-binding motif Length = 517 Score = 29.1 bits (62), Expect = 3.3 Identities = 14/44 (31%), Positives = 19/44 (43%) Frame = +3 Query: 207 PQNTWNAPPKPIQPINTYPQNNYAPPQNSYYPQNTYAPPQNTYR 338 P + + PKPI P YPQ +Y P + P P+ R Sbjct: 111 PSQRYVSSPKPISPRVAYPQVHYPKPPSPKPPSPRAVSPRIVQR 154 >At3g24550.1 68416.m03083 protein kinase family protein contains Pfam domain PF00069: Protein kinase domain Length = 652 Score = 29.1 bits (62), Expect = 3.3 Identities = 16/41 (39%), Positives = 21/41 (51%) Frame = +3 Query: 189 PPIQWKPQNTWNAPPKPIQPINTYPQNNYAPPQNSYYPQNT 311 PP+ PQ + +AP P P T P N +PP + P NT Sbjct: 75 PPL---PQPSPSAPITPSPPSPTTPSNPRSPPSPNQGPPNT 112 >At2g20320.1 68415.m02373 DENN (AEX-3) domain-containing protein contains Pfam domain PF02141: DENN (AEX-3) domain Length = 976 Score = 29.1 bits (62), Expect = 3.3 Identities = 21/38 (55%), Positives = 24/38 (63%), Gaps = 3/38 (7%) Frame = +2 Query: 251 KHL-SPKQLRPP-SKLILSSEYICSS-SKHISSHLEHA 355 +HL S RPP S L LS EYICSS SK I++ L A Sbjct: 760 EHLQSISYTRPPVSALGLSEEYICSSDSKEINARLAAA 797 >At4g35800.1 68417.m05087 DNA-directed RNA polymerase II largest subunit (RPB205) (RPII) (RPB1) nearly identical to P|P18616 DNA-directed RNA polymerase II largest subunit (EC 2.7.7.6) {Arabidopsis thaliana} Length = 1840 Score = 28.7 bits (61), Expect = 4.4 Identities = 17/48 (35%), Positives = 24/48 (50%), Gaps = 4/48 (8%) Frame = +3 Query: 189 PPIQWKPQNTWNAPPKPIQPI--NTYPQN-NYAPPQNSYYPQN-TYAP 320 P I + P N +P P P N P + +Y+P SY P + TY+P Sbjct: 1736 PSIAYSPSNARLSPASPYSPTSPNYSPTSPSYSPTSPSYSPSSPTYSP 1783 >At1g67140.1 68414.m07638 expressed protein Length = 2158 Score = 28.7 bits (61), Expect = 4.4 Identities = 16/34 (47%), Positives = 18/34 (52%) Frame = -2 Query: 596 ASLVGPVVDGVNFAISSSVRVPALFHQACLFCVG 495 AS P DG NFA S + A+F ACL VG Sbjct: 1627 ASSQKPYTDGTNFAADSGFHLRAIF-GACLHMVG 1659 >At1g49490.1 68414.m05547 leucine-rich repeat family protein / extensin family protein contains similarity to disease resistance protein GI:3894383 from [Lycopersicon esculentum]; contains leucine-rich repeats, Pfam:PF00560; contains proline rich extensin domains, INTERPRO:IPR002965 Length = 847 Score = 28.7 bits (61), Expect = 4.4 Identities = 15/46 (32%), Positives = 24/46 (52%), Gaps = 1/46 (2%) Frame = +3 Query: 189 PPIQWKPQNTWNAPPKPIQPINTYPQNNYAPPQNSYY-PQNTYAPP 323 PP + P +PP P P+ + P +++PP Y P T++PP Sbjct: 596 PPPVFSPPPPVFSPPPP-SPVYSPPPPSHSPPPPVYSPPPPTFSPP 640 Score = 27.9 bits (59), Expect = 7.6 Identities = 14/50 (28%), Positives = 24/50 (48%), Gaps = 5/50 (10%) Frame = +3 Query: 189 PPIQWKPQNTWNAPP-----KPIQPINTYPQNNYAPPQNSYYPQNTYAPP 323 PP+ P +++PP P P+ + P + PP +S P ++PP Sbjct: 554 PPVHSPPPPVYSSPPPPHVYSPPPPVASPPPPSPPPPVHSPPPPPVFSPP 603 >At1g21670.1 68414.m02712 expressed protein similar to TolB protein precursor (SP:P50601) {Pseudomonas aeruginosa} Length = 703 Score = 28.7 bits (61), Expect = 4.4 Identities = 11/29 (37%), Positives = 18/29 (62%) Frame = +3 Query: 441 EYQIADGTHVGEEGYFTNPNTEEASLVKK 527 E+++ DG + GYF +P+T SL+ K Sbjct: 63 EHRLTDGKSINFNGYFASPSTALISLLPK 91 >At1g09070.1 68414.m01012 C2 domain-containing protein / src2-like protein, putative similar to cold-regulated gene SRC2 [Glycine max] GI:2055230; contains Pfam profile PF00168: C2 domain; identical to cDNA src2-like protein GI:3426059 Length = 324 Score = 28.7 bits (61), Expect = 4.4 Identities = 18/44 (40%), Positives = 20/44 (45%), Gaps = 2/44 (4%) Frame = +3 Query: 201 WKPQNTWNAPPKPIQPINTYPQNNYAPPQNSY-YP-QNTYAPPQ 326 + PQ P P Q YPQ Y PPQ Y YP Q + PQ Sbjct: 230 YPPQQQGGYPGYPPQGPYGYPQQGY-PPQGPYGYPQQQAHGKPQ 272 >At5g02880.1 68418.m00231 HECT-domain-containing protein / ubiquitin-transferase family protein / armadillo/beta-catenin-like repeat-containing protein similar to SP|Q14669 Thyroid receptor interacting protein 12 (TRIP12) {Homo sapiens}; contains Pfam profiles PF00632: HECT-domain (ubiquitin-transferase), PF00514: Armadillo/beta-catenin-like repeat Length = 1502 Score = 28.3 bits (60), Expect = 5.8 Identities = 10/21 (47%), Positives = 14/21 (66%) Frame = -1 Query: 561 LCHQLQCKSTSPFSPGLPLLC 499 +C QL +S SPF +P+LC Sbjct: 263 ICKQLSSESPSPFMDAVPILC 283 >At4g21670.1 68417.m03139 double-stranded RNA-binding domain (DsRBD)-containing protein contains Pfam profile PF00035: Double-stranded RNA binding motif Length = 981 Score = 28.3 bits (60), Expect = 5.8 Identities = 19/79 (24%), Positives = 41/79 (51%) Frame = +2 Query: 161 QLVRTFEPEPAYPVETSKYVERSTQADPADKHLSPKQLRPPSKLILSSEYICSSSKHISS 340 +++ + P +P SK ++ STQ+D + + RPP + + E + S++ S Sbjct: 653 EMIHMEKHRPRHPSFFSK-IDNSTQSD----RMLHENRRPPKESLRRDEQLRSNNNLPDS 707 Query: 341 HLEHAFISDFDYNNSRSSD 397 H + + ++ ++SR+SD Sbjct: 708 HPFYGEDASWNQSSSRNSD 726 >At4g14070.1 68417.m02172 AMP-binding protein, putative similar to AMP-binding protein [gi:1617272] from Brassica napus; contains Pfam AMP-binding enzyme domain PF00501; identical to cDNA acyl-CoA synthetase-like protein GI:20799730 Length = 727 Score = 28.3 bits (60), Expect = 5.8 Identities = 12/33 (36%), Positives = 20/33 (60%) Frame = +3 Query: 477 EGYFTNPNTEEASLVKKGWYSYTGADGKVYTVH 575 +GY+ NP+T + L + GW++ TG G + H Sbjct: 555 KGYYKNPSTTKQVLNESGWFN-TGDTGWIAPHH 586 >At4g08380.1 68417.m01384 proline-rich extensin-like family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 437 Score = 28.3 bits (60), Expect = 5.8 Identities = 15/50 (30%), Positives = 21/50 (42%), Gaps = 1/50 (2%) Frame = +3 Query: 189 PPIQWKPQNTWNAPPKPIQPINTYPQNNY-APPQNSYYPQNTYAPPQNTY 335 PP + P +PP P + P Y +PP Y P + PP +Y Sbjct: 378 PPYTYSPPPYAYSPPPPCPDVYKPPPYVYSSPPPYVYNPPPSSPPPSPSY 427 >At5g15140.1 68418.m01774 aldose 1-epimerase family protein similar to SP|P05149 Aldose 1-epimerase precursor (EC 5.1.3.3) (Mutarotase) from Acinetobacter calcoaceticus; contains Pfam profile PF01263 Aldose 1-epimerase Length = 490 Score = 27.9 bits (59), Expect = 7.6 Identities = 13/33 (39%), Positives = 22/33 (66%), Gaps = 1/33 (3%) Frame = +3 Query: 18 LILIVAAFLAVTFADNVE-SDKEIEDSEAAESV 113 L++ + ++VTFADNVE K++E S+ + V Sbjct: 12 LLVTLGVVISVTFADNVELKSKDLESSKKDKKV 44 >At4g26750.1 68417.m03854 hydroxyproline-rich glycoprotein family protein Length = 421 Score = 27.9 bits (59), Expect = 7.6 Identities = 12/26 (46%), Positives = 14/26 (53%) Frame = +3 Query: 246 PINTYPQNNYAPPQNSYYPQNTYAPP 323 P N YP + PP S YP N + PP Sbjct: 223 PTNDYPAD-VPPPPPSSYPSNDHLPP 247 >At3g62200.1 68416.m06988 expressed protein contains Pfam profile PF04396: Protein of unknown function, DUF537 Length = 673 Score = 27.9 bits (59), Expect = 7.6 Identities = 17/51 (33%), Positives = 25/51 (49%), Gaps = 7/51 (13%) Frame = +3 Query: 204 KPQNTWNAPPKPIQP---INTYPQNNYAPPQN----SYYPQNTYAPPQNTY 335 +P + + PP P P +NT+P N PQN +Y P+ PP+ Y Sbjct: 262 EPSVSTSRPPPPNLPSSNVNTFPGNVMTNPQNQNQYTYPPRPGPFPPRQPY 312 >At3g04980.1 68416.m00541 DNAJ heat shock N-terminal domain-containing protein contains Pfam profile PF00226 DnaJ domain Length = 1165 Score = 27.9 bits (59), Expect = 7.6 Identities = 14/40 (35%), Positives = 21/40 (52%), Gaps = 1/40 (2%) Frame = +2 Query: 302 SEYICSSSKHISSHLEHAFISDFDYNNSRSSDQ-ERNVLW 418 S Y + H+S H + + FD+ N RS D+ E N +W Sbjct: 937 STYKSPRTTHVSPHCKTPRRNAFDFQNLRSEDKFEVNQIW 976 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 15,663,293 Number of Sequences: 28952 Number of extensions: 360524 Number of successful extensions: 1605 Number of sequences better than 10.0: 37 Number of HSP's better than 10.0 without gapping: 1256 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1533 length of database: 12,070,560 effective HSP length: 79 effective length of database: 9,783,352 effective search space used: 1663169840 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -