BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= brP-0293 (750 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_58219| Best HMM Match : SOCS_box (HMM E-Value=2e-07) 56 4e-08 SB_30777| Best HMM Match : SH2 (HMM E-Value=4e-10) 49 4e-06 SB_37681| Best HMM Match : SH2 (HMM E-Value=3.5e-11) 47 2e-05 SB_16900| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.027 SB_10902| Best HMM Match : SH3_1 (HMM E-Value=0) 30 2.3 SB_6423| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 2.3 SB_32162| Best HMM Match : Ras (HMM E-Value=4.7e-31) 30 2.3 SB_21360| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 2.3 SB_10926| Best HMM Match : Pkinase (HMM E-Value=3e-24) 29 3.0 SB_7446| Best HMM Match : SH2 (HMM E-Value=2.7e-22) 29 4.0 SB_23313| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.0 SB_48194| Best HMM Match : Dysbindin (HMM E-Value=3.1) 29 5.3 SB_55215| Best HMM Match : Peptidase_A16_N (HMM E-Value=0.0003) 29 5.3 SB_40820| Best HMM Match : Pkinase_Tyr (HMM E-Value=0) 29 5.3 SB_37260| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 5.3 SB_34627| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 7.0 SB_33663| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 7.0 SB_30220| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 7.0 SB_13047| Best HMM Match : Pro_3_hydrox_C (HMM E-Value=7) 28 7.0 SB_12796| Best HMM Match : Radical_SAM (HMM E-Value=8.9e-24) 28 7.0 SB_8638| Best HMM Match : PP2C (HMM E-Value=6.5e-32) 28 7.0 SB_6049| Best HMM Match : SH2 (HMM E-Value=8.4e-30) 28 7.0 SB_35911| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 7.0 SB_29763| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 7.0 SB_18572| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 7.0 SB_59645| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 9.3 SB_59194| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 9.3 SB_58676| Best HMM Match : FUN14 (HMM E-Value=0.16) 28 9.3 SB_58639| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 9.3 SB_58623| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 9.3 SB_58410| Best HMM Match : Umbravirus_LDM (HMM E-Value=5.8) 28 9.3 SB_57920| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 9.3 SB_57210| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 9.3 SB_56445| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 9.3 SB_55896| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 9.3 SB_55179| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 9.3 SB_55096| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 9.3 SB_54894| Best HMM Match : RuvB_C (HMM E-Value=2.3) 28 9.3 SB_53915| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 9.3 SB_53615| Best HMM Match : GETHR (HMM E-Value=5.3e-09) 28 9.3 SB_53012| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 9.3 SB_52037| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 9.3 SB_51674| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 9.3 SB_51499| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 9.3 SB_50666| Best HMM Match : ig (HMM E-Value=2.8e-20) 28 9.3 SB_50584| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 9.3 SB_50510| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 9.3 SB_50269| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 9.3 SB_50037| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 9.3 SB_49291| Best HMM Match : Herpes_UL69 (HMM E-Value=4.5) 28 9.3 SB_49138| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 9.3 SB_48746| Best HMM Match : fn3 (HMM E-Value=7.2) 28 9.3 SB_48519| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 9.3 SB_47856| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 9.3 SB_47784| Best HMM Match : Ank (HMM E-Value=1.4e-08) 28 9.3 SB_47451| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 9.3 SB_47049| Best HMM Match : Ribosomal_L15e (HMM E-Value=0.69) 28 9.3 SB_45437| Best HMM Match : Ribosomal_L15e (HMM E-Value=0.53) 28 9.3 SB_45327| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 9.3 SB_44994| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 9.3 SB_44738| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 9.3 SB_42734| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 9.3 SB_42360| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 9.3 SB_42151| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 9.3 SB_42061| Best HMM Match : CcoS (HMM E-Value=1.5) 28 9.3 SB_41957| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 9.3 SB_41059| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 9.3 SB_40873| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 9.3 SB_40612| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 9.3 SB_40524| Best HMM Match : Ribosomal_S18 (HMM E-Value=2) 28 9.3 SB_39914| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 9.3 SB_39337| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 9.3 SB_39248| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 9.3 SB_38896| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 9.3 SB_38748| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 9.3 SB_38234| Best HMM Match : RuvB_C (HMM E-Value=7) 28 9.3 SB_38187| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 9.3 SB_36515| Best HMM Match : UPF0126 (HMM E-Value=0.73) 28 9.3 SB_36468| Best HMM Match : DUF1643 (HMM E-Value=4.1) 28 9.3 SB_36183| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 9.3 SB_35514| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 9.3 SB_35069| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 9.3 SB_34721| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 9.3 SB_34207| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 9.3 SB_34127| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 9.3 SB_34032| Best HMM Match : 7tm_1 (HMM E-Value=1.3e-22) 28 9.3 SB_33901| Best HMM Match : RVT_1 (HMM E-Value=5.5e-30) 28 9.3 SB_33167| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 9.3 SB_33062| Best HMM Match : DUF485 (HMM E-Value=7.5) 28 9.3 SB_32080| Best HMM Match : Plasmid_stabil (HMM E-Value=5.7) 28 9.3 SB_31947| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 9.3 SB_31774| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 9.3 SB_31098| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 9.3 SB_30603| Best HMM Match : PKD_channel (HMM E-Value=1.2e-15) 28 9.3 SB_30119| Best HMM Match : VWC (HMM E-Value=2.1) 28 9.3 SB_29872| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 9.3 SB_29430| Best HMM Match : AhpC-TSA (HMM E-Value=0.00012) 28 9.3 SB_29254| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 9.3 SB_29238| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 9.3 SB_27679| Best HMM Match : zf-MYND (HMM E-Value=0.00039) 28 9.3 SB_26979| Best HMM Match : THF_DHG_CYH_C (HMM E-Value=0.017) 28 9.3 SB_26811| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 9.3 SB_24858| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 9.3 SB_24766| Best HMM Match : Plasmid_stabil (HMM E-Value=7.3) 28 9.3 SB_24481| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 9.3 SB_24446| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 9.3 SB_23906| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 9.3 SB_23492| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 9.3 SB_23266| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 9.3 SB_23148| Best HMM Match : DUF1491 (HMM E-Value=9.3) 28 9.3 SB_21952| Best HMM Match : Pertussis_S2S3 (HMM E-Value=3.2) 28 9.3 SB_21736| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 9.3 SB_20088| Best HMM Match : OAD_gamma (HMM E-Value=3) 28 9.3 SB_19974| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 9.3 SB_19756| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 9.3 SB_19194| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 9.3 SB_18659| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 9.3 SB_17152| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 9.3 SB_16892| Best HMM Match : TIL (HMM E-Value=4.4) 28 9.3 SB_16821| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 9.3 SB_16697| Best HMM Match : Collagen (HMM E-Value=4.2e-11) 28 9.3 SB_16601| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 9.3 SB_16131| Best HMM Match : RhoGEF (HMM E-Value=2e-05) 28 9.3 SB_15111| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 9.3 SB_15016| Best HMM Match : Peptidase_C9 (HMM E-Value=7.2) 28 9.3 SB_14043| Best HMM Match : Extensin_1 (HMM E-Value=0.75) 28 9.3 SB_13723| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 9.3 SB_13248| Best HMM Match : SCP (HMM E-Value=2.6e-21) 28 9.3 SB_12755| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 9.3 SB_12438| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 9.3 SB_12289| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 9.3 SB_11969| Best HMM Match : Papilloma_E5 (HMM E-Value=4.6) 28 9.3 SB_11820| Best HMM Match : EGF_2 (HMM E-Value=9.8) 28 9.3 SB_11146| Best HMM Match : K_tetra (HMM E-Value=1.1e-34) 28 9.3 SB_9574| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 9.3 SB_9532| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 9.3 SB_9512| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 9.3 SB_9470| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 9.3 SB_8947| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 9.3 SB_8444| Best HMM Match : BRE (HMM E-Value=6.4) 28 9.3 SB_8427| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 9.3 SB_8359| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 9.3 SB_8047| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 9.3 SB_7275| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 9.3 SB_7053| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 9.3 SB_6916| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 9.3 SB_6150| Best HMM Match : GAT (HMM E-Value=2.3e-34) 28 9.3 SB_5713| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 9.3 SB_5443| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 9.3 SB_5310| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 9.3 SB_5128| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 9.3 SB_4813| Best HMM Match : EMP24_GP25L (HMM E-Value=3.9e-13) 28 9.3 SB_4398| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 9.3 SB_3996| Best HMM Match : Connexin (HMM E-Value=2.4) 28 9.3 SB_3825| Best HMM Match : Pheromone (HMM E-Value=3.3) 28 9.3 SB_3664| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 9.3 SB_3135| Best HMM Match : KorB_C (HMM E-Value=2.8) 28 9.3 SB_2945| Best HMM Match : NADH_dehy_S2_C (HMM E-Value=4.4) 28 9.3 SB_2451| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 9.3 SB_2317| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 9.3 SB_1908| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 9.3 SB_1601| Best HMM Match : RuvB_C (HMM E-Value=3.6) 28 9.3 SB_941| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 9.3 SB_630| Best HMM Match : Pox_F17 (HMM E-Value=2.4) 28 9.3 SB_602| Best HMM Match : TSP_1 (HMM E-Value=1e-27) 28 9.3 SB_215| Best HMM Match : ALG3 (HMM E-Value=0.18) 28 9.3 SB_12| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 9.3 SB_59622| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 9.3 SB_59470| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 9.3 SB_59436| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 9.3 SB_59341| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 9.3 SB_59321| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 9.3 SB_59114| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 9.3 SB_58497| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 9.3 SB_58355| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 9.3 SB_58133| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 9.3 SB_57986| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 9.3 SB_57694| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 9.3 SB_57590| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 9.3 SB_57559| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 9.3 SB_57358| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 9.3 SB_57221| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 9.3 SB_56778| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 9.3 SB_56683| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 9.3 SB_56485| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 9.3 SB_56405| Best HMM Match : Fels1 (HMM E-Value=6.5) 28 9.3 SB_56072| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 9.3 SB_55971| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 9.3 SB_55894| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 9.3 SB_55772| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 9.3 SB_55573| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 9.3 SB_55103| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 9.3 SB_55047| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 9.3 SB_54903| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 9.3 SB_54851| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 9.3 SB_54599| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 9.3 SB_54482| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 9.3 SB_54353| Best HMM Match : RuvB_C (HMM E-Value=3.6) 28 9.3 SB_54325| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 9.3 SB_53936| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 9.3 SB_53836| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 9.3 SB_53698| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 9.3 SB_53493| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 9.3 SB_53207| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 9.3 SB_52948| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 9.3 SB_52761| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 9.3 SB_52662| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 9.3 SB_52635| Best HMM Match : THF_DHG_CYH_C (HMM E-Value=1.3) 28 9.3 SB_52572| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 9.3 SB_52560| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 9.3 SB_52557| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 9.3 SB_51972| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 9.3 SB_51882| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 9.3 SB_51647| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 9.3 SB_51566| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 9.3 SB_51213| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 9.3 SB_51064| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 9.3 SB_50537| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 9.3 SB_50527| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 9.3 SB_50288| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 9.3 SB_49737| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 9.3 SB_49720| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 9.3 SB_49124| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 9.3 SB_48785| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 9.3 SB_48664| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 9.3 SB_48482| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 9.3 SB_47984| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 9.3 SB_47738| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 9.3 SB_47507| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 9.3 SB_47297| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 9.3 SB_47238| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 9.3 SB_46711| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 9.3 SB_46709| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 9.3 SB_46514| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 9.3 SB_46370| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 9.3 SB_46352| Best HMM Match : L71 (HMM E-Value=0.19) 28 9.3 SB_46282| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 9.3 SB_46221| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 9.3 SB_45973| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 9.3 SB_45953| Best HMM Match : LRR_1 (HMM E-Value=7.4e-15) 28 9.3 SB_45744| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 9.3 SB_45699| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 9.3 SB_45621| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 9.3 SB_45526| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 9.3 SB_45393| Best HMM Match : Pkinase_Tyr (HMM E-Value=0.088) 28 9.3 SB_45253| Best HMM Match : ig (HMM E-Value=0.00016) 28 9.3 SB_45037| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 9.3 SB_44899| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 9.3 SB_44811| Best HMM Match : Toxin_33 (HMM E-Value=8.1) 28 9.3 SB_44593| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 9.3 SB_44336| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 9.3 SB_44213| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 9.3 SB_44147| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 9.3 SB_44009| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 9.3 SB_44008| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 9.3 SB_43854| Best HMM Match : Ribosomal_L15e (HMM E-Value=1.7) 28 9.3 SB_43776| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 9.3 SB_43277| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 9.3 SB_43222| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 9.3 SB_43062| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 9.3 SB_43007| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 9.3 SB_42249| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 9.3 SB_42173| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 9.3 SB_42028| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 9.3 SB_41969| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 9.3 SB_41303| Best HMM Match : DUF485 (HMM E-Value=2) 28 9.3 SB_40919| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 9.3 SB_40898| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 9.3 SB_40785| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 9.3 SB_40759| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 9.3 SB_40752| Best HMM Match : Ribosomal_L15e (HMM E-Value=2.5) 28 9.3 SB_40658| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 9.3 SB_40596| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 9.3 SB_40501| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 9.3 SB_40404| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 9.3 SB_40215| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 9.3 SB_40094| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 9.3 SB_39735| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 9.3 SB_39642| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 9.3 SB_39544| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 9.3 SB_39336| Best HMM Match : Kinesin (HMM E-Value=0) 28 9.3 SB_39320| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 9.3 SB_39283| Best HMM Match : ADK (HMM E-Value=3.7) 28 9.3 SB_39131| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 9.3 SB_39083| Best HMM Match : PhaC_N (HMM E-Value=0.7) 28 9.3 SB_39081| Best HMM Match : Pertussis_S2S3 (HMM E-Value=9.8) 28 9.3 SB_38904| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 9.3 SB_38654| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 9.3 SB_38562| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 9.3 SB_38368| Best HMM Match : zf-C3HC4 (HMM E-Value=4.4e-15) 28 9.3 SB_38317| Best HMM Match : bZIP_2 (HMM E-Value=5.1e-14) 28 9.3 SB_38140| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 9.3 SB_37833| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 9.3 SB_37700| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 9.3 SB_37689| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 9.3 SB_37634| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 9.3 SB_37586| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 9.3 SB_37467| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 9.3 SB_37442| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 9.3 SB_37275| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 9.3 SB_37081| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 9.3 SB_36845| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 9.3 SB_36843| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 9.3 SB_36822| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 9.3 SB_36672| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 9.3 SB_36551| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 9.3 SB_36497| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 9.3 SB_36480| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 9.3 SB_36092| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 9.3 SB_36066| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 9.3 SB_36059| Best HMM Match : TolA (HMM E-Value=0.1) 28 9.3 SB_36015| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 9.3 SB_35809| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 9.3 SB_35778| Best HMM Match : Dickkopf_N (HMM E-Value=2.4) 28 9.3 SB_35695| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 9.3 SB_35616| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 9.3 SB_35502| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 9.3 SB_35393| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 9.3 SB_35230| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 9.3 SB_35217| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 9.3 SB_35048| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 9.3 SB_34691| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 9.3 SB_34444| Best HMM Match : Cadherin (HMM E-Value=0.0043) 28 9.3 SB_34399| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 9.3 SB_34374| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 9.3 SB_34337| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 9.3 SB_34227| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 9.3 SB_34125| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 9.3 SB_34092| Best HMM Match : RuvB_C (HMM E-Value=3.6) 28 9.3 SB_33664| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 9.3 SB_33490| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 9.3 SB_33488| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 9.3 SB_33325| Best HMM Match : ShTK (HMM E-Value=6.3e-10) 28 9.3 SB_33281| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 9.3 SB_33205| Best HMM Match : Mucin (HMM E-Value=0.0024) 28 9.3 SB_32541| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 9.3 SB_32443| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 9.3 SB_32291| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 9.3 SB_32217| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 9.3 SB_32188| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 9.3 SB_32050| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 9.3 SB_31853| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 9.3 SB_31524| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 9.3 SB_31275| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 9.3 SB_30889| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 9.3 SB_30687| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 9.3 SB_30453| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 9.3 SB_30166| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 9.3 SB_30004| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 9.3 SB_29812| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 9.3 SB_29620| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 9.3 SB_29583| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 9.3 SB_29441| Best HMM Match : MFS_1 (HMM E-Value=1.6e-12) 28 9.3 SB_29433| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 9.3 SB_29380| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 9.3 SB_29161| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 9.3 SB_29146| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 9.3 SB_28829| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 9.3 SB_28797| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 9.3 SB_28439| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 9.3 SB_28284| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 9.3 SB_28002| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 9.3 SB_27895| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 9.3 SB_27641| Best HMM Match : Ank (HMM E-Value=8.6e-05) 28 9.3 SB_27625| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 9.3 SB_27082| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 9.3 SB_26894| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 9.3 SB_26697| Best HMM Match : EGF (HMM E-Value=7.5e-34) 28 9.3 SB_26278| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 9.3 SB_26034| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 9.3 SB_26029| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 9.3 SB_25779| Best HMM Match : DUF485 (HMM E-Value=5.1) 28 9.3 SB_25252| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 9.3 SB_25111| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 9.3 SB_24900| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 9.3 SB_24899| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 9.3 SB_24625| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 9.3 SB_24609| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 9.3 SB_24394| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 9.3 SB_24302| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 9.3 SB_24239| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 9.3 SB_23976| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 9.3 SB_23972| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 9.3 SB_23930| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 9.3 SB_23315| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 9.3 SB_23224| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 9.3 SB_23079| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 9.3 SB_23046| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 9.3 SB_22871| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 9.3 SB_22743| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 9.3 SB_22715| Best HMM Match : SAM_PNT (HMM E-Value=1.8) 28 9.3 SB_22691| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 9.3 SB_22298| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 9.3 SB_22087| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 9.3 SB_21944| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 9.3 SB_21601| Best HMM Match : Ribosomal_L15e (HMM E-Value=2.4) 28 9.3 SB_21249| Best HMM Match : Fels1 (HMM E-Value=8.3) 28 9.3 SB_21220| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 9.3 SB_21197| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 9.3 SB_21163| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 9.3 SB_21132| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 9.3 SB_21115| Best HMM Match : Swi3 (HMM E-Value=6.9) 28 9.3 SB_20993| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 9.3 SB_20955| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 9.3 SB_20344| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 9.3 SB_20082| Best HMM Match : DUF378 (HMM E-Value=4.1) 28 9.3 SB_20043| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 9.3 SB_19841| Best HMM Match : Myb_DNA-binding (HMM E-Value=1.1) 28 9.3 SB_19497| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 9.3 SB_19464| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 9.3 SB_19432| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 9.3 SB_19022| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 9.3 SB_18824| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 9.3 SB_18805| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 9.3 SB_18801| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 9.3 SB_18630| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 9.3 SB_18544| Best HMM Match : 7tm_1 (HMM E-Value=0.00082) 28 9.3 SB_18337| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 9.3 SB_18037| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 9.3 SB_17968| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 9.3 SB_17922| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 9.3 SB_17258| Best HMM Match : DUF791 (HMM E-Value=0.002) 28 9.3 SB_17135| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 9.3 SB_16840| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 9.3 SB_16777| Best HMM Match : Ribosomal_L15e (HMM E-Value=2.4) 28 9.3 SB_16764| Best HMM Match : ACPS (HMM E-Value=4.4) 28 9.3 SB_16602| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 9.3 SB_16512| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 9.3 SB_16421| Best HMM Match : HD-ZIP_N (HMM E-Value=7.6) 28 9.3 SB_16384| Best HMM Match : Ribosomal_L15e (HMM E-Value=1.1) 28 9.3 SB_16324| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 9.3 SB_16112| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 9.3 SB_16101| Best HMM Match : RVT_1 (HMM E-Value=0.00031) 28 9.3 SB_15857| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 9.3 SB_15771| Best HMM Match : VQ (HMM E-Value=4.3) 28 9.3 SB_15715| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 9.3 SB_15545| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 9.3 SB_15218| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 9.3 SB_15175| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 9.3 SB_15145| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 9.3 SB_14983| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 9.3 SB_14808| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 9.3 SB_14442| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 9.3 SB_14379| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 9.3 SB_14356| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 9.3 SB_14291| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 9.3 SB_13637| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 9.3 SB_13233| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 9.3 SB_12576| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 9.3 SB_12547| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 9.3 SB_12526| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 9.3 SB_12145| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 9.3 SB_11965| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 9.3 SB_11390| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 9.3 SB_11105| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 9.3 SB_10967| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 9.3 SB_10941| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 9.3 SB_10936| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 9.3 SB_10912| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 9.3 SB_10853| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 9.3 SB_10723| Best HMM Match : Chromo (HMM E-Value=0.031) 28 9.3 SB_10695| Best HMM Match : Pollen_Ole_e_I (HMM E-Value=5.2) 28 9.3 SB_10650| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 9.3 SB_10623| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 9.3 SB_10590| Best HMM Match : DUF485 (HMM E-Value=7.3) 28 9.3 SB_9879| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 9.3 SB_9823| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 9.3 SB_9713| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 9.3 SB_9545| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 9.3 SB_9530| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 9.3 SB_9528| Best HMM Match : 7tm_1 (HMM E-Value=2.6e-39) 28 9.3 SB_9475| Best HMM Match : PAN (HMM E-Value=0.0022) 28 9.3 SB_9384| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 9.3 SB_9371| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 9.3 SB_9155| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 9.3 SB_9135| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 9.3 SB_9004| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 9.3 SB_8423| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 9.3 SB_8316| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 9.3 SB_8089| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 9.3 SB_7935| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 9.3 SB_7697| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 9.3 SB_7274| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 9.3 SB_6789| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 9.3 SB_6524| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 9.3 SB_6469| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 9.3 SB_6458| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 9.3 SB_6296| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 9.3 SB_5965| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 9.3 SB_5755| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 9.3 SB_5643| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 9.3 SB_5500| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 9.3 SB_5051| Best HMM Match : DUF1193 (HMM E-Value=0.88) 28 9.3 SB_5028| Best HMM Match : Fels1 (HMM E-Value=8.3) 28 9.3 SB_5006| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 9.3 SB_4934| Best HMM Match : NAD_binding_2 (HMM E-Value=4.8) 28 9.3 SB_4630| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 9.3 SB_3953| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 9.3 SB_3927| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 9.3 SB_3444| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 9.3 >SB_58219| Best HMM Match : SOCS_box (HMM E-Value=2e-07) Length = 507 Score = 55.6 bits (128), Expect = 4e-08 Identities = 26/45 (57%), Positives = 30/45 (66%) Frame = +3 Query: 594 LYNHGWYWGGITSSEAEXLLAGQHDNVFLVRDSYDSRHILCVSFR 728 L N GWYWG ++S EAE L Q D FLVRDS + H+L VSFR Sbjct: 340 LSNCGWYWGPMSSKEAEKELYNQPDGCFLVRDSENDYHLLSVSFR 384 >SB_30777| Best HMM Match : SH2 (HMM E-Value=4e-10) Length = 265 Score = 49.2 bits (112), Expect = 4e-06 Identities = 22/48 (45%), Positives = 30/48 (62%) Frame = +3 Query: 585 YCQLYNHGWYWGGITSSEAEXLLAGQHDNVFLVRDSYDSRHILCVSFR 728 + L GW+WG + +AE +LAG+ D FLVRDS +S +L VS R Sbjct: 163 FMNLSEQGWFWGAMRYEDAEQVLAGRPDGSFLVRDSTNSFDLLVVSVR 210 >SB_37681| Best HMM Match : SH2 (HMM E-Value=3.5e-11) Length = 421 Score = 46.8 bits (106), Expect = 2e-05 Identities = 21/46 (45%), Positives = 28/46 (60%) Frame = +3 Query: 591 QLYNHGWYWGGITSSEAEXLLAGQHDNVFLVRDSYDSRHILCVSFR 728 ++ N WYWG I EAE +L G D FL+RDS +++ VSFR Sbjct: 252 EITNCPWYWGKINRFEAERVLDGLPDGTFLLRDSAQYQYLFSVSFR 297 >SB_16900| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 451 Score = 36.3 bits (80), Expect = 0.027 Identities = 19/45 (42%), Positives = 25/45 (55%) Frame = +3 Query: 594 LYNHGWYWGGITSSEAEXLLAGQHDNVFLVRDSYDSRHILCVSFR 728 L H WY G I+ + AE LL+ + FLVR+S S L +S R Sbjct: 98 LEKHSWYHGQISRNAAEYLLSSGINGSFLVRESESSPGQLSISLR 142 >SB_10902| Best HMM Match : SH3_1 (HMM E-Value=0) Length = 824 Score = 29.9 bits (64), Expect = 2.3 Identities = 14/32 (43%), Positives = 18/32 (56%), Gaps = 1/32 (3%) Frame = +3 Query: 600 NHGWYWGGITSSEAEXLLAGQ-HDNVFLVRDS 692 N W+WG I+ + E LL D FLVR+S Sbjct: 373 NQEWFWGRISRRQGEQLLLNHGTDGDFLVRES 404 >SB_6423| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 29.9 bits (64), Expect = 2.3 Identities = 12/39 (30%), Positives = 20/39 (51%) Frame = -3 Query: 748 AVYGQPQRKETQRMCLESYESRTKKTLSCWPASNXSASL 632 A G +R+ + C+ SR+ + L CWP S + +L Sbjct: 2 AAIGDNRRRRHESYCVGPTRSRSVQNLQCWPDSERAMAL 40 >SB_32162| Best HMM Match : Ras (HMM E-Value=4.7e-31) Length = 357 Score = 29.9 bits (64), Expect = 2.3 Identities = 18/53 (33%), Positives = 25/53 (47%), Gaps = 1/53 (1%) Frame = +3 Query: 132 YERCSYCNRRKWLTSGCLRKWIKPNS-MECKHLQRSIDKNKDTNIDIVDAILM 287 Y R C RKWLT+G W P + K +Q D KD+ + +A L+ Sbjct: 219 YARSFDCGERKWLTNGAEISWKMPGRYLTGKEIQ---DAKKDSIVTAKEAKLL 268 >SB_21360| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 66 Score = 29.9 bits (64), Expect = 2.3 Identities = 12/39 (30%), Positives = 20/39 (51%) Frame = -3 Query: 748 AVYGQPQRKETQRMCLESYESRTKKTLSCWPASNXSASL 632 A G +R+ + C+ SR+ + L CWP S + +L Sbjct: 3 AAIGDNRRRRHESYCVGPTRSRSVQNLQCWPDSERAMAL 41 >SB_10926| Best HMM Match : Pkinase (HMM E-Value=3e-24) Length = 1102 Score = 29.5 bits (63), Expect = 3.0 Identities = 14/44 (31%), Positives = 24/44 (54%) Frame = +3 Query: 486 HTLRPIMKCQHSKEGHSVLRSHHQHASLESCAIYCQLYNHGWYW 617 H R I CQH K+ +V RS H+ ++E + + ++H +W Sbjct: 52 HRFRTIANCQHRKDIRTVRRSFHE--TVEEINLIARSFSH-LFW 92 >SB_7446| Best HMM Match : SH2 (HMM E-Value=2.7e-22) Length = 699 Score = 29.1 bits (62), Expect = 4.0 Identities = 16/33 (48%), Positives = 19/33 (57%) Frame = +3 Query: 594 LYNHGWYWGGITSSEAEXLLAGQHDNVFLVRDS 692 L WY G I+ EAE LL + D FLVR+S Sbjct: 444 LVQKDWYHGPISRGEAELLLEDEGD--FLVRES 474 >SB_23313| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 65 Score = 29.1 bits (62), Expect = 4.0 Identities = 13/31 (41%), Positives = 20/31 (64%) Frame = +3 Query: 618 GGITSSEAEXLLAGQHDNVFLVRDSYDSRHI 710 G IT S+ L G+ N+F+V SY+++HI Sbjct: 6 GKITRSKLRWLEKGETLNIFIVLKSYNNKHI 36 >SB_48194| Best HMM Match : Dysbindin (HMM E-Value=3.1) Length = 314 Score = 28.7 bits (61), Expect = 5.3 Identities = 26/92 (28%), Positives = 40/92 (43%), Gaps = 3/92 (3%) Frame = +3 Query: 300 SSLNTNKFVKLWKSKFFITTSVRSLQRYFGKSRGADSICKLNKSNDPTSAFE-TRYGIGI 476 S + T K L + + I + Q G DS+ K NKS PT +Y I Sbjct: 175 SKIKTRKSTPLNELRESILFIDNNRQNRQGSVEERDSLSKANKSTIPTFPSPICQYDITR 234 Query: 477 EI--KHTLRPIMKCQHSKEGHSVLRSHHQHAS 566 E+ K T I + + ++EG+ +L H+S Sbjct: 235 ELNDKETKSSINRTRLNQEGNEILVESELHSS 266 >SB_55215| Best HMM Match : Peptidase_A16_N (HMM E-Value=0.0003) Length = 458 Score = 28.7 bits (61), Expect = 5.3 Identities = 19/68 (27%), Positives = 28/68 (41%), Gaps = 7/68 (10%) Frame = +3 Query: 132 YERCSYCNRRKWLTSGCLRKWIKP------NSMECKHLQRSIDKNKDTNIDIVDAILMP- 290 Y R C RKWLT+G W P N+ + K ++ + K D + P Sbjct: 75 YARSFDCGERKWLTNGAEISWKMPGRYLTGNASKRKRKRKKVSKEIDCTGKRISTTFGPI 134 Query: 291 EPNSSLNT 314 EP+ + T Sbjct: 135 EPDRRMAT 142 >SB_40820| Best HMM Match : Pkinase_Tyr (HMM E-Value=0) Length = 526 Score = 28.7 bits (61), Expect = 5.3 Identities = 13/34 (38%), Positives = 21/34 (61%) Frame = +3 Query: 591 QLYNHGWYWGGITSSEAEXLLAGQHDNVFLVRDS 692 +L+ W+ G I ++E LL + D +FLVR+S Sbjct: 197 KLHAMPWFHGKIEREKSEELLQPRTDGLFLVRES 230 >SB_37260| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 818 Score = 28.7 bits (61), Expect = 5.3 Identities = 24/107 (22%), Positives = 43/107 (40%), Gaps = 6/107 (5%) Frame = +3 Query: 132 YERCSYCNRRKWLTSGCLRKWIKPN---SMECKHLQRSIDKNKDTNIDIVDAILMPEPNS 302 Y R C RKWLT+G W P + K + + K + + + + Sbjct: 92 YARSFDCGERKWLTNGAEISWKMPGRYLTGNPKRTEPLLPKRQVDGDCVTMTLSFTHDDH 151 Query: 303 SLNTNKFVKL-WKSKFFITTSVRSLQRYFG--KSRGADSICKLNKSN 434 +++ + L + K+ TT+ L R +S+ D +C+ N N Sbjct: 152 AVSLTRIYSLCYALKYLNTTTYFRLNRKKSSVESQIRDKVCENNPEN 198 >SB_34627| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1925 Score = 28.3 bits (60), Expect = 7.0 Identities = 11/35 (31%), Positives = 18/35 (51%) Frame = -1 Query: 159 VGYNTNIVHNLCSSSTFNCHLCNINYSDLTVSFIN 55 VGY N + +LC T H+ N D+ + F++ Sbjct: 34 VGYKCNAIKSLCLHPTTKDHIDNAGLPDIHMGFVS 68 >SB_33663| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 518 Score = 28.3 bits (60), Expect = 7.0 Identities = 16/44 (36%), Positives = 23/44 (52%), Gaps = 2/44 (4%) Frame = +3 Query: 609 WYWGGITSSEAEXLLAG--QHDNVFLVRDSYDSRHILCVSFRXG 734 W++G I EAE LL FL+RDS ++ + +S R G Sbjct: 136 WFYGPIKRPEAEKLLQSPPNEHGAFLIRDS--NKGLFALSMRDG 177 >SB_30220| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 566 Score = 28.3 bits (60), Expect = 7.0 Identities = 13/37 (35%), Positives = 21/37 (56%) Frame = -3 Query: 406 SAPRDLPKYLCKDLTLVVIKNLLFQSFTNLLVFRDEL 296 +A D Y C++L L I+ +F+ F N L+ DE+ Sbjct: 176 TARNDSQVYHCRELALAYIQCEVFRRFKNALISDDEI 212 >SB_13047| Best HMM Match : Pro_3_hydrox_C (HMM E-Value=7) Length = 271 Score = 28.3 bits (60), Expect = 7.0 Identities = 11/35 (31%), Positives = 18/35 (51%) Frame = -1 Query: 159 VGYNTNIVHNLCSSSTFNCHLCNINYSDLTVSFIN 55 VGY N + +LC T H+ N D+ + F++ Sbjct: 34 VGYKCNAIKSLCLHPTTKDHIDNAGLPDIHMGFVS 68 >SB_12796| Best HMM Match : Radical_SAM (HMM E-Value=8.9e-24) Length = 676 Score = 28.3 bits (60), Expect = 7.0 Identities = 14/50 (28%), Positives = 25/50 (50%), Gaps = 1/50 (2%) Frame = +3 Query: 288 PEPNSSLNTNKFVKLWKSKFFITTSV-RSLQRYFGKSRGADSICKLNKSN 434 P+PN +NT + + W + + TSV R G A+++ ++ K N Sbjct: 98 PDPNEPINTAEAISRWNLDYIVITSVDRDDLPDGGAGHFAETVRQIKKRN 147 >SB_8638| Best HMM Match : PP2C (HMM E-Value=6.5e-32) Length = 905 Score = 28.3 bits (60), Expect = 7.0 Identities = 20/80 (25%), Positives = 31/80 (38%), Gaps = 3/80 (3%) Frame = +3 Query: 123 NISYERCSYCNRRKWLTSGCLRKWIKPNSMECKHLQRSIDKNKDTNIDIVD-AILMPEPN 299 N+ ++CS C + + C R K + CK + S D D + P Sbjct: 15 NVQLQKCSRCKSTMYCSKDCPRSHWKHHKAICKAKKHSKDSKLDVSTTTAPLRFSQPMSK 74 Query: 300 SSLNTNKFV--KLWKSKFFI 353 +S FV +L KS F + Sbjct: 75 NSETLANFVVEELTKSNFCV 94 >SB_6049| Best HMM Match : SH2 (HMM E-Value=8.4e-30) Length = 94 Score = 28.3 bits (60), Expect = 7.0 Identities = 16/44 (36%), Positives = 23/44 (52%), Gaps = 2/44 (4%) Frame = +3 Query: 609 WYWGGITSSEAEXLLAG--QHDNVFLVRDSYDSRHILCVSFRXG 734 W++G I EAE LL FL+RDS ++ + +S R G Sbjct: 2 WFYGPIKRPEAEKLLQSPPNEHGAFLIRDS--NKGLFALSMRDG 43 >SB_35911| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 105 Score = 28.3 bits (60), Expect = 7.0 Identities = 11/27 (40%), Positives = 13/27 (48%) Frame = +3 Query: 132 YERCSYCNRRKWLTSGCLRKWIKPNSM 212 Y R C RKWLT+G W P + Sbjct: 75 YARSFDCGERKWLTNGAEISWKMPGKI 101 >SB_29763| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 143 Score = 28.3 bits (60), Expect = 7.0 Identities = 13/28 (46%), Positives = 17/28 (60%) Frame = +1 Query: 361 ASDPYKDISVNHEGLIQFANLIRAMTPH 444 +SDP + VNHEG LIR+ TP+ Sbjct: 69 SSDPKMKMYVNHEGTRTLNLLIRSQTPY 96 >SB_18572| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 105 Score = 28.3 bits (60), Expect = 7.0 Identities = 11/27 (40%), Positives = 13/27 (48%) Frame = +3 Query: 132 YERCSYCNRRKWLTSGCLRKWIKPNSM 212 Y R C RKWLT+G W P + Sbjct: 75 YARSFDCGERKWLTNGAEISWKMPGKI 101 >SB_59645| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 142 Score = 27.9 bits (59), Expect = 9.3 Identities = 11/24 (45%), Positives = 12/24 (50%) Frame = +3 Query: 132 YERCSYCNRRKWLTSGCLRKWIKP 203 Y R C RKWLT+G W P Sbjct: 112 YARSFDCGERKWLTNGAEISWKMP 135 >SB_59194| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 122 Score = 27.9 bits (59), Expect = 9.3 Identities = 11/24 (45%), Positives = 12/24 (50%) Frame = +3 Query: 132 YERCSYCNRRKWLTSGCLRKWIKP 203 Y R C RKWLT+G W P Sbjct: 92 YARSFDCGERKWLTNGAEISWKMP 115 >SB_58676| Best HMM Match : FUN14 (HMM E-Value=0.16) Length = 217 Score = 27.9 bits (59), Expect = 9.3 Identities = 11/24 (45%), Positives = 12/24 (50%) Frame = +3 Query: 132 YERCSYCNRRKWLTSGCLRKWIKP 203 Y R C RKWLT+G W P Sbjct: 187 YARSFDCGERKWLTNGAEISWKMP 210 >SB_58639| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 122 Score = 27.9 bits (59), Expect = 9.3 Identities = 11/24 (45%), Positives = 12/24 (50%) Frame = +3 Query: 132 YERCSYCNRRKWLTSGCLRKWIKP 203 Y R C RKWLT+G W P Sbjct: 92 YARSFDCGERKWLTNGAEISWKMP 115 >SB_58623| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 142 Score = 27.9 bits (59), Expect = 9.3 Identities = 11/24 (45%), Positives = 12/24 (50%) Frame = +3 Query: 132 YERCSYCNRRKWLTSGCLRKWIKP 203 Y R C RKWLT+G W P Sbjct: 112 YARSFDCGERKWLTNGAEISWKMP 135 >SB_58410| Best HMM Match : Umbravirus_LDM (HMM E-Value=5.8) Length = 341 Score = 27.9 bits (59), Expect = 9.3 Identities = 11/24 (45%), Positives = 12/24 (50%) Frame = +3 Query: 132 YERCSYCNRRKWLTSGCLRKWIKP 203 Y R C RKWLT+G W P Sbjct: 311 YARSFDCGERKWLTNGAEISWKMP 334 >SB_57920| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 105 Score = 27.9 bits (59), Expect = 9.3 Identities = 11/24 (45%), Positives = 12/24 (50%) Frame = +3 Query: 132 YERCSYCNRRKWLTSGCLRKWIKP 203 Y R C RKWLT+G W P Sbjct: 75 YARSFDCGERKWLTNGAEISWKMP 98 >SB_57210| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 179 Score = 27.9 bits (59), Expect = 9.3 Identities = 11/24 (45%), Positives = 12/24 (50%) Frame = +3 Query: 132 YERCSYCNRRKWLTSGCLRKWIKP 203 Y R C RKWLT+G W P Sbjct: 149 YARSFDCGERKWLTNGAEISWKMP 172 >SB_56445| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 166 Score = 27.9 bits (59), Expect = 9.3 Identities = 11/24 (45%), Positives = 12/24 (50%) Frame = +3 Query: 132 YERCSYCNRRKWLTSGCLRKWIKP 203 Y R C RKWLT+G W P Sbjct: 136 YARSFDCGERKWLTNGAEISWKMP 159 >SB_55896| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 191 Score = 27.9 bits (59), Expect = 9.3 Identities = 11/24 (45%), Positives = 12/24 (50%) Frame = +3 Query: 132 YERCSYCNRRKWLTSGCLRKWIKP 203 Y R C RKWLT+G W P Sbjct: 161 YARSFDCGERKWLTNGAEISWKMP 184 >SB_55179| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 122 Score = 27.9 bits (59), Expect = 9.3 Identities = 11/24 (45%), Positives = 12/24 (50%) Frame = +3 Query: 132 YERCSYCNRRKWLTSGCLRKWIKP 203 Y R C RKWLT+G W P Sbjct: 92 YARSFDCGERKWLTNGAEISWKMP 115 >SB_55096| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 105 Score = 27.9 bits (59), Expect = 9.3 Identities = 11/24 (45%), Positives = 12/24 (50%) Frame = +3 Query: 132 YERCSYCNRRKWLTSGCLRKWIKP 203 Y R C RKWLT+G W P Sbjct: 75 YARSFDCGERKWLTNGAEISWKMP 98 >SB_54894| Best HMM Match : RuvB_C (HMM E-Value=2.3) Length = 148 Score = 27.9 bits (59), Expect = 9.3 Identities = 11/24 (45%), Positives = 12/24 (50%) Frame = +3 Query: 132 YERCSYCNRRKWLTSGCLRKWIKP 203 Y R C RKWLT+G W P Sbjct: 118 YARSFDCGERKWLTNGAEISWKMP 141 >SB_53915| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 178 Score = 27.9 bits (59), Expect = 9.3 Identities = 11/24 (45%), Positives = 12/24 (50%) Frame = +3 Query: 132 YERCSYCNRRKWLTSGCLRKWIKP 203 Y R C RKWLT+G W P Sbjct: 148 YARSFDCGERKWLTNGAEISWKMP 171 >SB_53615| Best HMM Match : GETHR (HMM E-Value=5.3e-09) Length = 653 Score = 27.9 bits (59), Expect = 9.3 Identities = 11/24 (45%), Positives = 12/24 (50%) Frame = +3 Query: 132 YERCSYCNRRKWLTSGCLRKWIKP 203 Y R C RKWLT+G W P Sbjct: 266 YARSFDCGERKWLTNGAEISWKMP 289 >SB_53012| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 138 Score = 27.9 bits (59), Expect = 9.3 Identities = 11/24 (45%), Positives = 12/24 (50%) Frame = +3 Query: 132 YERCSYCNRRKWLTSGCLRKWIKP 203 Y R C RKWLT+G W P Sbjct: 108 YARSFDCGERKWLTNGAEISWKMP 131 >SB_52037| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 137 Score = 27.9 bits (59), Expect = 9.3 Identities = 11/24 (45%), Positives = 12/24 (50%) Frame = +3 Query: 132 YERCSYCNRRKWLTSGCLRKWIKP 203 Y R C RKWLT+G W P Sbjct: 107 YARSFDCGERKWLTNGAEISWKMP 130 >SB_51674| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 833 Score = 27.9 bits (59), Expect = 9.3 Identities = 11/24 (45%), Positives = 12/24 (50%) Frame = +3 Query: 132 YERCSYCNRRKWLTSGCLRKWIKP 203 Y R C RKWLT+G W P Sbjct: 408 YARSFDCGERKWLTNGAEISWKMP 431 >SB_51499| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 122 Score = 27.9 bits (59), Expect = 9.3 Identities = 11/24 (45%), Positives = 12/24 (50%) Frame = +3 Query: 132 YERCSYCNRRKWLTSGCLRKWIKP 203 Y R C RKWLT+G W P Sbjct: 92 YARSFDCGERKWLTNGAEISWKMP 115 >SB_50666| Best HMM Match : ig (HMM E-Value=2.8e-20) Length = 293 Score = 27.9 bits (59), Expect = 9.3 Identities = 11/24 (45%), Positives = 12/24 (50%) Frame = +3 Query: 132 YERCSYCNRRKWLTSGCLRKWIKP 203 Y R C RKWLT+G W P Sbjct: 263 YARSFDCGERKWLTNGAEISWKMP 286 >SB_50584| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 193 Score = 27.9 bits (59), Expect = 9.3 Identities = 11/24 (45%), Positives = 12/24 (50%) Frame = +3 Query: 132 YERCSYCNRRKWLTSGCLRKWIKP 203 Y R C RKWLT+G W P Sbjct: 163 YARSFDCGERKWLTNGAEISWKMP 186 >SB_50510| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 179 Score = 27.9 bits (59), Expect = 9.3 Identities = 11/24 (45%), Positives = 12/24 (50%) Frame = +3 Query: 132 YERCSYCNRRKWLTSGCLRKWIKP 203 Y R C RKWLT+G W P Sbjct: 149 YARSFDCGERKWLTNGAEISWKMP 172 >SB_50269| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 940 Score = 27.9 bits (59), Expect = 9.3 Identities = 11/24 (45%), Positives = 12/24 (50%) Frame = +3 Query: 132 YERCSYCNRRKWLTSGCLRKWIKP 203 Y R C RKWLT+G W P Sbjct: 626 YARSFDCGERKWLTNGAEISWKMP 649 >SB_50037| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 105 Score = 27.9 bits (59), Expect = 9.3 Identities = 11/24 (45%), Positives = 12/24 (50%) Frame = +3 Query: 132 YERCSYCNRRKWLTSGCLRKWIKP 203 Y R C RKWLT+G W P Sbjct: 75 YARSFDCGERKWLTNGAEISWKMP 98 >SB_49291| Best HMM Match : Herpes_UL69 (HMM E-Value=4.5) Length = 491 Score = 27.9 bits (59), Expect = 9.3 Identities = 11/24 (45%), Positives = 12/24 (50%) Frame = +3 Query: 132 YERCSYCNRRKWLTSGCLRKWIKP 203 Y R C RKWLT+G W P Sbjct: 382 YARSFDCGERKWLTNGAEISWKMP 405 >SB_49138| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 122 Score = 27.9 bits (59), Expect = 9.3 Identities = 11/24 (45%), Positives = 12/24 (50%) Frame = +3 Query: 132 YERCSYCNRRKWLTSGCLRKWIKP 203 Y R C RKWLT+G W P Sbjct: 92 YARSFDCGERKWLTNGAEISWKMP 115 >SB_48746| Best HMM Match : fn3 (HMM E-Value=7.2) Length = 255 Score = 27.9 bits (59), Expect = 9.3 Identities = 11/24 (45%), Positives = 12/24 (50%) Frame = +3 Query: 132 YERCSYCNRRKWLTSGCLRKWIKP 203 Y R C RKWLT+G W P Sbjct: 225 YARSFDCGERKWLTNGAEISWKMP 248 >SB_48519| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 105 Score = 27.9 bits (59), Expect = 9.3 Identities = 11/24 (45%), Positives = 12/24 (50%) Frame = +3 Query: 132 YERCSYCNRRKWLTSGCLRKWIKP 203 Y R C RKWLT+G W P Sbjct: 75 YARSFDCGERKWLTNGAEISWKMP 98 >SB_47856| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 213 Score = 27.9 bits (59), Expect = 9.3 Identities = 11/24 (45%), Positives = 12/24 (50%) Frame = +3 Query: 132 YERCSYCNRRKWLTSGCLRKWIKP 203 Y R C RKWLT+G W P Sbjct: 183 YARSFDCGERKWLTNGAEISWKMP 206 >SB_47784| Best HMM Match : Ank (HMM E-Value=1.4e-08) Length = 593 Score = 27.9 bits (59), Expect = 9.3 Identities = 11/24 (45%), Positives = 12/24 (50%) Frame = +3 Query: 132 YERCSYCNRRKWLTSGCLRKWIKP 203 Y R C RKWLT+G W P Sbjct: 147 YARSFDCGERKWLTNGAEISWKMP 170 >SB_47451| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 139 Score = 27.9 bits (59), Expect = 9.3 Identities = 11/24 (45%), Positives = 12/24 (50%) Frame = +3 Query: 132 YERCSYCNRRKWLTSGCLRKWIKP 203 Y R C RKWLT+G W P Sbjct: 109 YARSFDCGERKWLTNGAEISWKMP 132 >SB_47049| Best HMM Match : Ribosomal_L15e (HMM E-Value=0.69) Length = 178 Score = 27.9 bits (59), Expect = 9.3 Identities = 11/24 (45%), Positives = 12/24 (50%) Frame = +3 Query: 132 YERCSYCNRRKWLTSGCLRKWIKP 203 Y R C RKWLT+G W P Sbjct: 148 YARSFDCGERKWLTNGAEISWKMP 171 >SB_45437| Best HMM Match : Ribosomal_L15e (HMM E-Value=0.53) Length = 273 Score = 27.9 bits (59), Expect = 9.3 Identities = 11/24 (45%), Positives = 12/24 (50%) Frame = +3 Query: 132 YERCSYCNRRKWLTSGCLRKWIKP 203 Y R C RKWLT+G W P Sbjct: 194 YARSFDCGERKWLTNGAEISWKMP 217 >SB_45327| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 147 Score = 27.9 bits (59), Expect = 9.3 Identities = 11/24 (45%), Positives = 12/24 (50%) Frame = +3 Query: 132 YERCSYCNRRKWLTSGCLRKWIKP 203 Y R C RKWLT+G W P Sbjct: 117 YARSFDCGERKWLTNGAEISWKMP 140 >SB_44994| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 182 Score = 27.9 bits (59), Expect = 9.3 Identities = 11/24 (45%), Positives = 12/24 (50%) Frame = +3 Query: 132 YERCSYCNRRKWLTSGCLRKWIKP 203 Y R C RKWLT+G W P Sbjct: 152 YARSFDCGERKWLTNGAEISWKMP 175 >SB_44738| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 122 Score = 27.9 bits (59), Expect = 9.3 Identities = 11/24 (45%), Positives = 12/24 (50%) Frame = +3 Query: 132 YERCSYCNRRKWLTSGCLRKWIKP 203 Y R C RKWLT+G W P Sbjct: 92 YARSFDCGERKWLTNGAEISWKMP 115 >SB_42734| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 198 Score = 27.9 bits (59), Expect = 9.3 Identities = 11/24 (45%), Positives = 12/24 (50%) Frame = +3 Query: 132 YERCSYCNRRKWLTSGCLRKWIKP 203 Y R C RKWLT+G W P Sbjct: 168 YARSFDCGERKWLTNGAEISWKMP 191 >SB_42360| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 122 Score = 27.9 bits (59), Expect = 9.3 Identities = 11/24 (45%), Positives = 12/24 (50%) Frame = +3 Query: 132 YERCSYCNRRKWLTSGCLRKWIKP 203 Y R C RKWLT+G W P Sbjct: 92 YARSFDCGERKWLTNGAEISWKMP 115 >SB_42151| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 122 Score = 27.9 bits (59), Expect = 9.3 Identities = 11/24 (45%), Positives = 12/24 (50%) Frame = +3 Query: 132 YERCSYCNRRKWLTSGCLRKWIKP 203 Y R C RKWLT+G W P Sbjct: 92 YARSFDCGERKWLTNGAEISWKMP 115 >SB_42061| Best HMM Match : CcoS (HMM E-Value=1.5) Length = 346 Score = 27.9 bits (59), Expect = 9.3 Identities = 11/24 (45%), Positives = 12/24 (50%) Frame = +3 Query: 132 YERCSYCNRRKWLTSGCLRKWIKP 203 Y R C RKWLT+G W P Sbjct: 92 YARSFDCGERKWLTNGAEISWKMP 115 >SB_41957| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 108 Score = 27.9 bits (59), Expect = 9.3 Identities = 11/24 (45%), Positives = 12/24 (50%) Frame = +3 Query: 132 YERCSYCNRRKWLTSGCLRKWIKP 203 Y R C RKWLT+G W P Sbjct: 78 YARSFDCGERKWLTNGAEISWKMP 101 >SB_41059| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 158 Score = 27.9 bits (59), Expect = 9.3 Identities = 11/24 (45%), Positives = 12/24 (50%) Frame = +3 Query: 132 YERCSYCNRRKWLTSGCLRKWIKP 203 Y R C RKWLT+G W P Sbjct: 128 YARSFDCGERKWLTNGAEISWKMP 151 >SB_40873| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2496 Score = 27.9 bits (59), Expect = 9.3 Identities = 11/24 (45%), Positives = 12/24 (50%) Frame = +3 Query: 132 YERCSYCNRRKWLTSGCLRKWIKP 203 Y R C RKWLT+G W P Sbjct: 615 YARSFDCGERKWLTNGAEISWKMP 638 >SB_40612| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 158 Score = 27.9 bits (59), Expect = 9.3 Identities = 11/24 (45%), Positives = 12/24 (50%) Frame = +3 Query: 132 YERCSYCNRRKWLTSGCLRKWIKP 203 Y R C RKWLT+G W P Sbjct: 128 YARSFDCGERKWLTNGAEISWKMP 151 >SB_40524| Best HMM Match : Ribosomal_S18 (HMM E-Value=2) Length = 216 Score = 27.9 bits (59), Expect = 9.3 Identities = 11/24 (45%), Positives = 12/24 (50%) Frame = +3 Query: 132 YERCSYCNRRKWLTSGCLRKWIKP 203 Y R C RKWLT+G W P Sbjct: 186 YARSFDCGERKWLTNGAEISWKMP 209 >SB_39914| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 141 Score = 27.9 bits (59), Expect = 9.3 Identities = 11/24 (45%), Positives = 12/24 (50%) Frame = +3 Query: 132 YERCSYCNRRKWLTSGCLRKWIKP 203 Y R C RKWLT+G W P Sbjct: 111 YARSFDCGERKWLTNGAEISWKMP 134 >SB_39337| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 105 Score = 27.9 bits (59), Expect = 9.3 Identities = 11/24 (45%), Positives = 12/24 (50%) Frame = +3 Query: 132 YERCSYCNRRKWLTSGCLRKWIKP 203 Y R C RKWLT+G W P Sbjct: 75 YARSFDCGERKWLTNGAEISWKMP 98 >SB_39248| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 105 Score = 27.9 bits (59), Expect = 9.3 Identities = 11/24 (45%), Positives = 12/24 (50%) Frame = +3 Query: 132 YERCSYCNRRKWLTSGCLRKWIKP 203 Y R C RKWLT+G W P Sbjct: 75 YARSFDCGERKWLTNGAEISWKMP 98 >SB_38896| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 122 Score = 27.9 bits (59), Expect = 9.3 Identities = 11/24 (45%), Positives = 12/24 (50%) Frame = +3 Query: 132 YERCSYCNRRKWLTSGCLRKWIKP 203 Y R C RKWLT+G W P Sbjct: 92 YARSFDCGERKWLTNGAEISWKMP 115 >SB_38748| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 162 Score = 27.9 bits (59), Expect = 9.3 Identities = 11/24 (45%), Positives = 12/24 (50%) Frame = +3 Query: 132 YERCSYCNRRKWLTSGCLRKWIKP 203 Y R C RKWLT+G W P Sbjct: 132 YARSFDCGERKWLTNGAEISWKMP 155 >SB_38234| Best HMM Match : RuvB_C (HMM E-Value=7) Length = 184 Score = 27.9 bits (59), Expect = 9.3 Identities = 11/24 (45%), Positives = 12/24 (50%) Frame = +3 Query: 132 YERCSYCNRRKWLTSGCLRKWIKP 203 Y R C RKWLT+G W P Sbjct: 154 YARSFDCGERKWLTNGAEISWKMP 177 >SB_38187| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 161 Score = 27.9 bits (59), Expect = 9.3 Identities = 11/24 (45%), Positives = 12/24 (50%) Frame = +3 Query: 132 YERCSYCNRRKWLTSGCLRKWIKP 203 Y R C RKWLT+G W P Sbjct: 131 YARSFDCGERKWLTNGAEISWKMP 154 >SB_36515| Best HMM Match : UPF0126 (HMM E-Value=0.73) Length = 150 Score = 27.9 bits (59), Expect = 9.3 Identities = 11/24 (45%), Positives = 12/24 (50%) Frame = +3 Query: 132 YERCSYCNRRKWLTSGCLRKWIKP 203 Y R C RKWLT+G W P Sbjct: 120 YARSFDCGERKWLTNGAEISWKMP 143 >SB_36468| Best HMM Match : DUF1643 (HMM E-Value=4.1) Length = 471 Score = 27.9 bits (59), Expect = 9.3 Identities = 16/74 (21%), Positives = 33/74 (44%), Gaps = 4/74 (5%) Frame = +3 Query: 135 ERCSYCNRRKWLTSGCLRKWIKPNSMECK-HLQRSIDKNKDTNIDIV---DAILMPEPNS 302 E CS C W +GC K ++ K + N+DT++++V + + +P S Sbjct: 107 EGCSTCCSTWWALAGCGMKSVETKYKHTKIKTALKLYSNRDTSMEVVRRFEELRLPRVTS 166 Query: 303 SLNTNKFVKLWKSK 344 + ++ W+ + Sbjct: 167 PAHISRAHLFWRRR 180 >SB_36183| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 122 Score = 27.9 bits (59), Expect = 9.3 Identities = 11/24 (45%), Positives = 12/24 (50%) Frame = +3 Query: 132 YERCSYCNRRKWLTSGCLRKWIKP 203 Y R C RKWLT+G W P Sbjct: 92 YARSFDCGERKWLTNGAEISWKMP 115 >SB_35514| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 177 Score = 27.9 bits (59), Expect = 9.3 Identities = 11/24 (45%), Positives = 12/24 (50%) Frame = +3 Query: 132 YERCSYCNRRKWLTSGCLRKWIKP 203 Y R C RKWLT+G W P Sbjct: 147 YARSFDCGERKWLTNGAEISWKMP 170 >SB_35069| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 175 Score = 27.9 bits (59), Expect = 9.3 Identities = 11/24 (45%), Positives = 12/24 (50%) Frame = +3 Query: 132 YERCSYCNRRKWLTSGCLRKWIKP 203 Y R C RKWLT+G W P Sbjct: 145 YARSFDCGERKWLTNGAEISWKMP 168 >SB_34721| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 144 Score = 27.9 bits (59), Expect = 9.3 Identities = 11/24 (45%), Positives = 12/24 (50%) Frame = +3 Query: 132 YERCSYCNRRKWLTSGCLRKWIKP 203 Y R C RKWLT+G W P Sbjct: 114 YARSFDCGERKWLTNGAEISWKMP 137 >SB_34207| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 282 Score = 27.9 bits (59), Expect = 9.3 Identities = 11/24 (45%), Positives = 12/24 (50%) Frame = +3 Query: 132 YERCSYCNRRKWLTSGCLRKWIKP 203 Y R C RKWLT+G W P Sbjct: 252 YARSFDCGERKWLTNGAEISWKMP 275 >SB_34127| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 105 Score = 27.9 bits (59), Expect = 9.3 Identities = 11/24 (45%), Positives = 12/24 (50%) Frame = +3 Query: 132 YERCSYCNRRKWLTSGCLRKWIKP 203 Y R C RKWLT+G W P Sbjct: 75 YARSFDCGERKWLTNGAEISWKMP 98 >SB_34032| Best HMM Match : 7tm_1 (HMM E-Value=1.3e-22) Length = 673 Score = 27.9 bits (59), Expect = 9.3 Identities = 11/24 (45%), Positives = 12/24 (50%) Frame = +3 Query: 132 YERCSYCNRRKWLTSGCLRKWIKP 203 Y R C RKWLT+G W P Sbjct: 643 YARSFDCGERKWLTNGAEISWKMP 666 >SB_33901| Best HMM Match : RVT_1 (HMM E-Value=5.5e-30) Length = 841 Score = 27.9 bits (59), Expect = 9.3 Identities = 11/24 (45%), Positives = 12/24 (50%) Frame = +3 Query: 132 YERCSYCNRRKWLTSGCLRKWIKP 203 Y R C RKWLT+G W P Sbjct: 365 YARSFDCGERKWLTNGAEISWKMP 388 >SB_33167| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 334 Score = 27.9 bits (59), Expect = 9.3 Identities = 11/24 (45%), Positives = 12/24 (50%) Frame = +3 Query: 132 YERCSYCNRRKWLTSGCLRKWIKP 203 Y R C RKWLT+G W P Sbjct: 112 YARSFDCGERKWLTNGAEISWKMP 135 >SB_33062| Best HMM Match : DUF485 (HMM E-Value=7.5) Length = 168 Score = 27.9 bits (59), Expect = 9.3 Identities = 11/24 (45%), Positives = 12/24 (50%) Frame = +3 Query: 132 YERCSYCNRRKWLTSGCLRKWIKP 203 Y R C RKWLT+G W P Sbjct: 138 YARSFDCGERKWLTNGAEISWKMP 161 >SB_32080| Best HMM Match : Plasmid_stabil (HMM E-Value=5.7) Length = 284 Score = 27.9 bits (59), Expect = 9.3 Identities = 11/24 (45%), Positives = 12/24 (50%) Frame = +3 Query: 132 YERCSYCNRRKWLTSGCLRKWIKP 203 Y R C RKWLT+G W P Sbjct: 254 YARSFDCGERKWLTNGAEISWKMP 277 >SB_31947| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 183 Score = 27.9 bits (59), Expect = 9.3 Identities = 11/24 (45%), Positives = 12/24 (50%) Frame = +3 Query: 132 YERCSYCNRRKWLTSGCLRKWIKP 203 Y R C RKWLT+G W P Sbjct: 153 YARSFDCGERKWLTNGAEISWKMP 176 >SB_31774| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 584 Score = 27.9 bits (59), Expect = 9.3 Identities = 11/24 (45%), Positives = 12/24 (50%) Frame = +3 Query: 132 YERCSYCNRRKWLTSGCLRKWIKP 203 Y R C RKWLT+G W P Sbjct: 554 YARSFDCGERKWLTNGAEISWKMP 577 >SB_31098| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 436 Score = 27.9 bits (59), Expect = 9.3 Identities = 11/24 (45%), Positives = 12/24 (50%) Frame = +3 Query: 132 YERCSYCNRRKWLTSGCLRKWIKP 203 Y R C RKWLT+G W P Sbjct: 92 YARSFDCGERKWLTNGAEISWKMP 115 >SB_30603| Best HMM Match : PKD_channel (HMM E-Value=1.2e-15) Length = 1029 Score = 27.9 bits (59), Expect = 9.3 Identities = 11/24 (45%), Positives = 12/24 (50%) Frame = +3 Query: 132 YERCSYCNRRKWLTSGCLRKWIKP 203 Y R C RKWLT+G W P Sbjct: 999 YARSFDCGERKWLTNGAEISWKMP 1022 >SB_30119| Best HMM Match : VWC (HMM E-Value=2.1) Length = 155 Score = 27.9 bits (59), Expect = 9.3 Identities = 11/24 (45%), Positives = 12/24 (50%) Frame = +3 Query: 132 YERCSYCNRRKWLTSGCLRKWIKP 203 Y R C RKWLT+G W P Sbjct: 125 YARSFDCGERKWLTNGAEISWKMP 148 >SB_29872| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 197 Score = 27.9 bits (59), Expect = 9.3 Identities = 11/24 (45%), Positives = 12/24 (50%) Frame = +3 Query: 132 YERCSYCNRRKWLTSGCLRKWIKP 203 Y R C RKWLT+G W P Sbjct: 167 YARSFDCGERKWLTNGAEISWKMP 190 >SB_29430| Best HMM Match : AhpC-TSA (HMM E-Value=0.00012) Length = 704 Score = 27.9 bits (59), Expect = 9.3 Identities = 11/24 (45%), Positives = 12/24 (50%) Frame = +3 Query: 132 YERCSYCNRRKWLTSGCLRKWIKP 203 Y R C RKWLT+G W P Sbjct: 504 YARSFDCGERKWLTNGAEISWKMP 527 >SB_29254| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 122 Score = 27.9 bits (59), Expect = 9.3 Identities = 11/24 (45%), Positives = 12/24 (50%) Frame = +3 Query: 132 YERCSYCNRRKWLTSGCLRKWIKP 203 Y R C RKWLT+G W P Sbjct: 92 YARSFDCGERKWLTNGAEISWKMP 115 >SB_29238| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 138 Score = 27.9 bits (59), Expect = 9.3 Identities = 11/24 (45%), Positives = 12/24 (50%) Frame = +3 Query: 132 YERCSYCNRRKWLTSGCLRKWIKP 203 Y R C RKWLT+G W P Sbjct: 108 YARSFDCGERKWLTNGAEISWKMP 131 >SB_27679| Best HMM Match : zf-MYND (HMM E-Value=0.00039) Length = 167 Score = 27.9 bits (59), Expect = 9.3 Identities = 11/24 (45%), Positives = 12/24 (50%) Frame = +3 Query: 132 YERCSYCNRRKWLTSGCLRKWIKP 203 Y R C RKWLT+G W P Sbjct: 137 YARSFDCGERKWLTNGAEISWKMP 160 >SB_26979| Best HMM Match : THF_DHG_CYH_C (HMM E-Value=0.017) Length = 453 Score = 27.9 bits (59), Expect = 9.3 Identities = 11/24 (45%), Positives = 12/24 (50%) Frame = +3 Query: 132 YERCSYCNRRKWLTSGCLRKWIKP 203 Y R C RKWLT+G W P Sbjct: 300 YARSFDCGERKWLTNGAEISWKMP 323 >SB_26811| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 105 Score = 27.9 bits (59), Expect = 9.3 Identities = 11/24 (45%), Positives = 12/24 (50%) Frame = +3 Query: 132 YERCSYCNRRKWLTSGCLRKWIKP 203 Y R C RKWLT+G W P Sbjct: 75 YARSFDCGERKWLTNGAEISWKMP 98 >SB_24858| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 105 Score = 27.9 bits (59), Expect = 9.3 Identities = 11/24 (45%), Positives = 12/24 (50%) Frame = +3 Query: 132 YERCSYCNRRKWLTSGCLRKWIKP 203 Y R C RKWLT+G W P Sbjct: 75 YARSFDCGERKWLTNGAEISWKMP 98 >SB_24766| Best HMM Match : Plasmid_stabil (HMM E-Value=7.3) Length = 149 Score = 27.9 bits (59), Expect = 9.3 Identities = 11/24 (45%), Positives = 12/24 (50%) Frame = +3 Query: 132 YERCSYCNRRKWLTSGCLRKWIKP 203 Y R C RKWLT+G W P Sbjct: 119 YARSFDCGERKWLTNGAEISWKMP 142 >SB_24481| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 149 Score = 27.9 bits (59), Expect = 9.3 Identities = 11/24 (45%), Positives = 12/24 (50%) Frame = +3 Query: 132 YERCSYCNRRKWLTSGCLRKWIKP 203 Y R C RKWLT+G W P Sbjct: 92 YARSFDCGERKWLTNGAEISWKMP 115 >SB_24446| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 122 Score = 27.9 bits (59), Expect = 9.3 Identities = 11/24 (45%), Positives = 12/24 (50%) Frame = +3 Query: 132 YERCSYCNRRKWLTSGCLRKWIKP 203 Y R C RKWLT+G W P Sbjct: 92 YARSFDCGERKWLTNGAEISWKMP 115 >SB_23906| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 119 Score = 27.9 bits (59), Expect = 9.3 Identities = 11/24 (45%), Positives = 12/24 (50%) Frame = +3 Query: 132 YERCSYCNRRKWLTSGCLRKWIKP 203 Y R C RKWLT+G W P Sbjct: 89 YARSFDCGERKWLTNGAEISWKMP 112 >SB_23492| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 239 Score = 27.9 bits (59), Expect = 9.3 Identities = 11/24 (45%), Positives = 12/24 (50%) Frame = +3 Query: 132 YERCSYCNRRKWLTSGCLRKWIKP 203 Y R C RKWLT+G W P Sbjct: 209 YARSFDCGERKWLTNGAEISWKMP 232 >SB_23266| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 324 Score = 27.9 bits (59), Expect = 9.3 Identities = 11/24 (45%), Positives = 12/24 (50%) Frame = +3 Query: 132 YERCSYCNRRKWLTSGCLRKWIKP 203 Y R C RKWLT+G W P Sbjct: 294 YARSFDCGERKWLTNGAEISWKMP 317 >SB_23148| Best HMM Match : DUF1491 (HMM E-Value=9.3) Length = 150 Score = 27.9 bits (59), Expect = 9.3 Identities = 11/24 (45%), Positives = 12/24 (50%) Frame = +3 Query: 132 YERCSYCNRRKWLTSGCLRKWIKP 203 Y R C RKWLT+G W P Sbjct: 120 YARSFDCGERKWLTNGAEISWKMP 143 >SB_21952| Best HMM Match : Pertussis_S2S3 (HMM E-Value=3.2) Length = 198 Score = 27.9 bits (59), Expect = 9.3 Identities = 11/24 (45%), Positives = 12/24 (50%) Frame = +3 Query: 132 YERCSYCNRRKWLTSGCLRKWIKP 203 Y R C RKWLT+G W P Sbjct: 168 YARSFDCGERKWLTNGAEISWKMP 191 >SB_21736| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 158 Score = 27.9 bits (59), Expect = 9.3 Identities = 11/24 (45%), Positives = 12/24 (50%) Frame = +3 Query: 132 YERCSYCNRRKWLTSGCLRKWIKP 203 Y R C RKWLT+G W P Sbjct: 128 YARSFDCGERKWLTNGAEISWKMP 151 >SB_20088| Best HMM Match : OAD_gamma (HMM E-Value=3) Length = 200 Score = 27.9 bits (59), Expect = 9.3 Identities = 11/24 (45%), Positives = 12/24 (50%) Frame = +3 Query: 132 YERCSYCNRRKWLTSGCLRKWIKP 203 Y R C RKWLT+G W P Sbjct: 170 YARSFDCGERKWLTNGAEISWKMP 193 >SB_19974| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 127 Score = 27.9 bits (59), Expect = 9.3 Identities = 11/24 (45%), Positives = 12/24 (50%) Frame = +3 Query: 132 YERCSYCNRRKWLTSGCLRKWIKP 203 Y R C RKWLT+G W P Sbjct: 75 YARSFDCGERKWLTNGAEISWKMP 98 >SB_19756| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 168 Score = 27.9 bits (59), Expect = 9.3 Identities = 11/24 (45%), Positives = 12/24 (50%) Frame = +3 Query: 132 YERCSYCNRRKWLTSGCLRKWIKP 203 Y R C RKWLT+G W P Sbjct: 138 YARSFDCGERKWLTNGAEISWKMP 161 >SB_19194| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 122 Score = 27.9 bits (59), Expect = 9.3 Identities = 11/24 (45%), Positives = 12/24 (50%) Frame = +3 Query: 132 YERCSYCNRRKWLTSGCLRKWIKP 203 Y R C RKWLT+G W P Sbjct: 92 YARSFDCGERKWLTNGAEISWKMP 115 >SB_18659| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 122 Score = 27.9 bits (59), Expect = 9.3 Identities = 11/24 (45%), Positives = 12/24 (50%) Frame = +3 Query: 132 YERCSYCNRRKWLTSGCLRKWIKP 203 Y R C RKWLT+G W P Sbjct: 92 YARSFDCGERKWLTNGAEISWKMP 115 >SB_17152| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 137 Score = 27.9 bits (59), Expect = 9.3 Identities = 11/24 (45%), Positives = 12/24 (50%) Frame = +3 Query: 132 YERCSYCNRRKWLTSGCLRKWIKP 203 Y R C RKWLT+G W P Sbjct: 107 YARSFDCGERKWLTNGAEISWKMP 130 >SB_16892| Best HMM Match : TIL (HMM E-Value=4.4) Length = 177 Score = 27.9 bits (59), Expect = 9.3 Identities = 11/24 (45%), Positives = 12/24 (50%) Frame = +3 Query: 132 YERCSYCNRRKWLTSGCLRKWIKP 203 Y R C RKWLT+G W P Sbjct: 147 YARSFDCGERKWLTNGAEISWKMP 170 >SB_16821| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 146 Score = 27.9 bits (59), Expect = 9.3 Identities = 11/24 (45%), Positives = 12/24 (50%) Frame = +3 Query: 132 YERCSYCNRRKWLTSGCLRKWIKP 203 Y R C RKWLT+G W P Sbjct: 116 YARSFDCGERKWLTNGAEISWKMP 139 >SB_16697| Best HMM Match : Collagen (HMM E-Value=4.2e-11) Length = 1903 Score = 27.9 bits (59), Expect = 9.3 Identities = 11/24 (45%), Positives = 12/24 (50%) Frame = +3 Query: 132 YERCSYCNRRKWLTSGCLRKWIKP 203 Y R C RKWLT+G W P Sbjct: 1010 YARSFDCGERKWLTNGAEISWKMP 1033 >SB_16601| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 187 Score = 27.9 bits (59), Expect = 9.3 Identities = 11/24 (45%), Positives = 12/24 (50%) Frame = +3 Query: 132 YERCSYCNRRKWLTSGCLRKWIKP 203 Y R C RKWLT+G W P Sbjct: 157 YARSFDCGERKWLTNGAEISWKMP 180 >SB_16131| Best HMM Match : RhoGEF (HMM E-Value=2e-05) Length = 520 Score = 27.9 bits (59), Expect = 9.3 Identities = 11/24 (45%), Positives = 12/24 (50%) Frame = +3 Query: 132 YERCSYCNRRKWLTSGCLRKWIKP 203 Y R C RKWLT+G W P Sbjct: 490 YARSFDCGERKWLTNGAEISWKMP 513 >SB_15111| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 150 Score = 27.9 bits (59), Expect = 9.3 Identities = 11/24 (45%), Positives = 12/24 (50%) Frame = +3 Query: 132 YERCSYCNRRKWLTSGCLRKWIKP 203 Y R C RKWLT+G W P Sbjct: 120 YARTFDCGERKWLTNGAEISWKMP 143 >SB_15016| Best HMM Match : Peptidase_C9 (HMM E-Value=7.2) Length = 202 Score = 27.9 bits (59), Expect = 9.3 Identities = 11/24 (45%), Positives = 12/24 (50%) Frame = +3 Query: 132 YERCSYCNRRKWLTSGCLRKWIKP 203 Y R C RKWLT+G W P Sbjct: 172 YARSFDCGERKWLTNGAEISWKMP 195 >SB_14043| Best HMM Match : Extensin_1 (HMM E-Value=0.75) Length = 568 Score = 27.9 bits (59), Expect = 9.3 Identities = 11/24 (45%), Positives = 12/24 (50%) Frame = +3 Query: 132 YERCSYCNRRKWLTSGCLRKWIKP 203 Y R C RKWLT+G W P Sbjct: 538 YARSFDCGERKWLTNGAEISWKMP 561 >SB_13723| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 175 Score = 27.9 bits (59), Expect = 9.3 Identities = 11/24 (45%), Positives = 12/24 (50%) Frame = +3 Query: 132 YERCSYCNRRKWLTSGCLRKWIKP 203 Y R C RKWLT+G W P Sbjct: 145 YARSFDCGERKWLTNGAEISWKMP 168 >SB_13248| Best HMM Match : SCP (HMM E-Value=2.6e-21) Length = 631 Score = 27.9 bits (59), Expect = 9.3 Identities = 11/24 (45%), Positives = 12/24 (50%) Frame = +3 Query: 132 YERCSYCNRRKWLTSGCLRKWIKP 203 Y R C RKWLT+G W P Sbjct: 536 YARSFDCGERKWLTNGAEISWKMP 559 >SB_12755| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 188 Score = 27.9 bits (59), Expect = 9.3 Identities = 11/24 (45%), Positives = 12/24 (50%) Frame = +3 Query: 132 YERCSYCNRRKWLTSGCLRKWIKP 203 Y R C RKWLT+G W P Sbjct: 158 YARSFDCGERKWLTNGAEISWKMP 181 >SB_12438| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 146 Score = 27.9 bits (59), Expect = 9.3 Identities = 11/24 (45%), Positives = 12/24 (50%) Frame = +3 Query: 132 YERCSYCNRRKWLTSGCLRKWIKP 203 Y R C RKWLT+G W P Sbjct: 116 YARSFDCGERKWLTNGAEISWKMP 139 >SB_12289| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 146 Score = 27.9 bits (59), Expect = 9.3 Identities = 11/24 (45%), Positives = 12/24 (50%) Frame = +3 Query: 132 YERCSYCNRRKWLTSGCLRKWIKP 203 Y R C RKWLT+G W P Sbjct: 116 YARSFDCGERKWLTNGAEISWKMP 139 >SB_11969| Best HMM Match : Papilloma_E5 (HMM E-Value=4.6) Length = 190 Score = 27.9 bits (59), Expect = 9.3 Identities = 11/24 (45%), Positives = 12/24 (50%) Frame = +3 Query: 132 YERCSYCNRRKWLTSGCLRKWIKP 203 Y R C RKWLT+G W P Sbjct: 160 YARSFDCGERKWLTNGAEISWKMP 183 >SB_11820| Best HMM Match : EGF_2 (HMM E-Value=9.8) Length = 197 Score = 27.9 bits (59), Expect = 9.3 Identities = 11/24 (45%), Positives = 12/24 (50%) Frame = +3 Query: 132 YERCSYCNRRKWLTSGCLRKWIKP 203 Y R C RKWLT+G W P Sbjct: 167 YARSFDCGERKWLTNGAEISWKMP 190 >SB_11146| Best HMM Match : K_tetra (HMM E-Value=1.1e-34) Length = 336 Score = 27.9 bits (59), Expect = 9.3 Identities = 11/24 (45%), Positives = 12/24 (50%) Frame = +3 Query: 132 YERCSYCNRRKWLTSGCLRKWIKP 203 Y R C RKWLT+G W P Sbjct: 306 YARSFDCGERKWLTNGAEISWKMP 329 >SB_9574| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 216 Score = 27.9 bits (59), Expect = 9.3 Identities = 11/24 (45%), Positives = 12/24 (50%) Frame = +3 Query: 132 YERCSYCNRRKWLTSGCLRKWIKP 203 Y R C RKWLT+G W P Sbjct: 186 YARSFDCGERKWLTNGAEISWKMP 209 >SB_9532| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1339 Score = 27.9 bits (59), Expect = 9.3 Identities = 11/24 (45%), Positives = 12/24 (50%) Frame = +3 Query: 132 YERCSYCNRRKWLTSGCLRKWIKP 203 Y R C RKWLT+G W P Sbjct: 1221 YARSFDCGERKWLTNGAEISWKMP 1244 >SB_9512| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 147 Score = 27.9 bits (59), Expect = 9.3 Identities = 11/24 (45%), Positives = 12/24 (50%) Frame = +3 Query: 132 YERCSYCNRRKWLTSGCLRKWIKP 203 Y R C RKWLT+G W P Sbjct: 117 YARSFDCGERKWLTNGAEISWKMP 140 >SB_9470| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 167 Score = 27.9 bits (59), Expect = 9.3 Identities = 11/24 (45%), Positives = 12/24 (50%) Frame = +3 Query: 132 YERCSYCNRRKWLTSGCLRKWIKP 203 Y R C RKWLT+G W P Sbjct: 137 YARSFDCGERKWLTNGAEISWKMP 160 >SB_8947| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 152 Score = 27.9 bits (59), Expect = 9.3 Identities = 11/24 (45%), Positives = 12/24 (50%) Frame = +3 Query: 132 YERCSYCNRRKWLTSGCLRKWIKP 203 Y R C RKWLT+G W P Sbjct: 122 YARSFDCGERKWLTNGAEISWKMP 145 >SB_8444| Best HMM Match : BRE (HMM E-Value=6.4) Length = 502 Score = 27.9 bits (59), Expect = 9.3 Identities = 11/24 (45%), Positives = 12/24 (50%) Frame = +3 Query: 132 YERCSYCNRRKWLTSGCLRKWIKP 203 Y R C RKWLT+G W P Sbjct: 75 YARSFDCGERKWLTNGAEISWKMP 98 >SB_8427| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 105 Score = 27.9 bits (59), Expect = 9.3 Identities = 11/24 (45%), Positives = 12/24 (50%) Frame = +3 Query: 132 YERCSYCNRRKWLTSGCLRKWIKP 203 Y R C RKWLT+G W P Sbjct: 75 YARSFDCGERKWLTNGAEISWKMP 98 >SB_8359| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 145 Score = 27.9 bits (59), Expect = 9.3 Identities = 11/24 (45%), Positives = 12/24 (50%) Frame = +3 Query: 132 YERCSYCNRRKWLTSGCLRKWIKP 203 Y R C RKWLT+G W P Sbjct: 115 YARSFDCGERKWLTNGAEISWKMP 138 >SB_8047| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 175 Score = 27.9 bits (59), Expect = 9.3 Identities = 11/24 (45%), Positives = 12/24 (50%) Frame = +3 Query: 132 YERCSYCNRRKWLTSGCLRKWIKP 203 Y R C RKWLT+G W P Sbjct: 145 YARSFDCGERKWLTNGAEISWKMP 168 >SB_7275| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 166 Score = 27.9 bits (59), Expect = 9.3 Identities = 11/24 (45%), Positives = 12/24 (50%) Frame = +3 Query: 132 YERCSYCNRRKWLTSGCLRKWIKP 203 Y R C RKWLT+G W P Sbjct: 136 YARSFDCGERKWLTNGAEISWKMP 159 >SB_7053| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 143 Score = 27.9 bits (59), Expect = 9.3 Identities = 11/24 (45%), Positives = 12/24 (50%) Frame = +3 Query: 132 YERCSYCNRRKWLTSGCLRKWIKP 203 Y R C RKWLT+G W P Sbjct: 113 YARSFDCGERKWLTNGAEISWKMP 136 >SB_6916| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2670 Score = 27.9 bits (59), Expect = 9.3 Identities = 11/24 (45%), Positives = 12/24 (50%) Frame = +3 Query: 132 YERCSYCNRRKWLTSGCLRKWIKP 203 Y R C RKWLT+G W P Sbjct: 1491 YARSFDCGERKWLTNGAEISWKMP 1514 >SB_6150| Best HMM Match : GAT (HMM E-Value=2.3e-34) Length = 674 Score = 27.9 bits (59), Expect = 9.3 Identities = 11/24 (45%), Positives = 12/24 (50%) Frame = +3 Query: 132 YERCSYCNRRKWLTSGCLRKWIKP 203 Y R C RKWLT+G W P Sbjct: 644 YARSFDCGERKWLTNGAEISWKMP 667 >SB_5713| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 134 Score = 27.9 bits (59), Expect = 9.3 Identities = 11/24 (45%), Positives = 12/24 (50%) Frame = +3 Query: 132 YERCSYCNRRKWLTSGCLRKWIKP 203 Y R C RKWLT+G W P Sbjct: 104 YARSFDCGERKWLTNGAEISWKMP 127 >SB_5443| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 371 Score = 27.9 bits (59), Expect = 9.3 Identities = 11/24 (45%), Positives = 12/24 (50%) Frame = +3 Query: 132 YERCSYCNRRKWLTSGCLRKWIKP 203 Y R C RKWLT+G W P Sbjct: 341 YARSFDCGERKWLTNGAEISWKMP 364 >SB_5310| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 219 Score = 27.9 bits (59), Expect = 9.3 Identities = 11/24 (45%), Positives = 12/24 (50%) Frame = +3 Query: 132 YERCSYCNRRKWLTSGCLRKWIKP 203 Y R C RKWLT+G W P Sbjct: 189 YARSFDCGERKWLTNGAEISWKMP 212 >SB_5128| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2102 Score = 27.9 bits (59), Expect = 9.3 Identities = 11/24 (45%), Positives = 12/24 (50%) Frame = +3 Query: 132 YERCSYCNRRKWLTSGCLRKWIKP 203 Y R C RKWLT+G W P Sbjct: 553 YARSFDCGERKWLTNGAEISWKMP 576 >SB_4813| Best HMM Match : EMP24_GP25L (HMM E-Value=3.9e-13) Length = 348 Score = 27.9 bits (59), Expect = 9.3 Identities = 11/24 (45%), Positives = 12/24 (50%) Frame = +3 Query: 132 YERCSYCNRRKWLTSGCLRKWIKP 203 Y R C RKWLT+G W P Sbjct: 92 YARSFDCGERKWLTNGAEISWKMP 115 >SB_4398| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 136 Score = 27.9 bits (59), Expect = 9.3 Identities = 11/24 (45%), Positives = 12/24 (50%) Frame = +3 Query: 132 YERCSYCNRRKWLTSGCLRKWIKP 203 Y R C RKWLT+G W P Sbjct: 106 YARSFDCGERKWLTNGAEISWKMP 129 >SB_3996| Best HMM Match : Connexin (HMM E-Value=2.4) Length = 205 Score = 27.9 bits (59), Expect = 9.3 Identities = 11/24 (45%), Positives = 12/24 (50%) Frame = +3 Query: 132 YERCSYCNRRKWLTSGCLRKWIKP 203 Y R C RKWLT+G W P Sbjct: 175 YARSFDCGERKWLTNGAEISWKMP 198 >SB_3825| Best HMM Match : Pheromone (HMM E-Value=3.3) Length = 189 Score = 27.9 bits (59), Expect = 9.3 Identities = 11/24 (45%), Positives = 12/24 (50%) Frame = +3 Query: 132 YERCSYCNRRKWLTSGCLRKWIKP 203 Y R C RKWLT+G W P Sbjct: 159 YARSFDCGERKWLTNGAEISWKMP 182 >SB_3664| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 189 Score = 27.9 bits (59), Expect = 9.3 Identities = 11/24 (45%), Positives = 12/24 (50%) Frame = +3 Query: 132 YERCSYCNRRKWLTSGCLRKWIKP 203 Y R C RKWLT+G W P Sbjct: 159 YARSFDCGERKWLTNGAEISWKMP 182 >SB_3135| Best HMM Match : KorB_C (HMM E-Value=2.8) Length = 227 Score = 27.9 bits (59), Expect = 9.3 Identities = 11/24 (45%), Positives = 12/24 (50%) Frame = +3 Query: 132 YERCSYCNRRKWLTSGCLRKWIKP 203 Y R C RKWLT+G W P Sbjct: 197 YARSFDCGERKWLTNGAEISWKMP 220 >SB_2945| Best HMM Match : NADH_dehy_S2_C (HMM E-Value=4.4) Length = 157 Score = 27.9 bits (59), Expect = 9.3 Identities = 11/24 (45%), Positives = 12/24 (50%) Frame = +3 Query: 132 YERCSYCNRRKWLTSGCLRKWIKP 203 Y R C RKWLT+G W P Sbjct: 127 YARSFDCGERKWLTNGAEISWKMP 150 >SB_2451| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 122 Score = 27.9 bits (59), Expect = 9.3 Identities = 11/24 (45%), Positives = 12/24 (50%) Frame = +3 Query: 132 YERCSYCNRRKWLTSGCLRKWIKP 203 Y R C RKWLT+G W P Sbjct: 92 YARSFDCGERKWLTNGAEISWKMP 115 >SB_2317| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 199 Score = 27.9 bits (59), Expect = 9.3 Identities = 11/24 (45%), Positives = 12/24 (50%) Frame = +3 Query: 132 YERCSYCNRRKWLTSGCLRKWIKP 203 Y R C RKWLT+G W P Sbjct: 169 YARSFDCGERKWLTNGAEISWKMP 192 >SB_1908| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 138 Score = 27.9 bits (59), Expect = 9.3 Identities = 11/24 (45%), Positives = 12/24 (50%) Frame = +3 Query: 132 YERCSYCNRRKWLTSGCLRKWIKP 203 Y R C RKWLT+G W P Sbjct: 108 YARSFDCGERKWLTNGAEISWKMP 131 >SB_1601| Best HMM Match : RuvB_C (HMM E-Value=3.6) Length = 237 Score = 27.9 bits (59), Expect = 9.3 Identities = 11/24 (45%), Positives = 12/24 (50%) Frame = +3 Query: 132 YERCSYCNRRKWLTSGCLRKWIKP 203 Y R C RKWLT+G W P Sbjct: 207 YARSFDCGERKWLTNGAEISWKMP 230 >SB_941| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 164 Score = 27.9 bits (59), Expect = 9.3 Identities = 11/24 (45%), Positives = 12/24 (50%) Frame = +3 Query: 132 YERCSYCNRRKWLTSGCLRKWIKP 203 Y R C RKWLT+G W P Sbjct: 134 YARSFDCGERKWLTNGAEISWKMP 157 >SB_630| Best HMM Match : Pox_F17 (HMM E-Value=2.4) Length = 160 Score = 27.9 bits (59), Expect = 9.3 Identities = 11/24 (45%), Positives = 12/24 (50%) Frame = +3 Query: 132 YERCSYCNRRKWLTSGCLRKWIKP 203 Y R C RKWLT+G W P Sbjct: 130 YARSFDCGERKWLTNGAEISWKMP 153 >SB_602| Best HMM Match : TSP_1 (HMM E-Value=1e-27) Length = 590 Score = 27.9 bits (59), Expect = 9.3 Identities = 11/24 (45%), Positives = 12/24 (50%) Frame = +3 Query: 132 YERCSYCNRRKWLTSGCLRKWIKP 203 Y R C RKWLT+G W P Sbjct: 560 YARSFDCGERKWLTNGAEISWKMP 583 >SB_215| Best HMM Match : ALG3 (HMM E-Value=0.18) Length = 521 Score = 27.9 bits (59), Expect = 9.3 Identities = 11/24 (45%), Positives = 12/24 (50%) Frame = +3 Query: 132 YERCSYCNRRKWLTSGCLRKWIKP 203 Y R C RKWLT+G W P Sbjct: 455 YARSFDCGERKWLTNGAEISWKMP 478 >SB_12| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 144 Score = 27.9 bits (59), Expect = 9.3 Identities = 11/24 (45%), Positives = 12/24 (50%) Frame = +3 Query: 132 YERCSYCNRRKWLTSGCLRKWIKP 203 Y R C RKWLT+G W P Sbjct: 92 YARSFDCGERKWLTNGAEISWKMP 115 >SB_59622| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 105 Score = 27.9 bits (59), Expect = 9.3 Identities = 11/24 (45%), Positives = 12/24 (50%) Frame = +3 Query: 132 YERCSYCNRRKWLTSGCLRKWIKP 203 Y R C RKWLT+G W P Sbjct: 75 YARSFDCGERKWLTNGAEISWKMP 98 >SB_59470| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 105 Score = 27.9 bits (59), Expect = 9.3 Identities = 11/24 (45%), Positives = 12/24 (50%) Frame = +3 Query: 132 YERCSYCNRRKWLTSGCLRKWIKP 203 Y R C RKWLT+G W P Sbjct: 75 YARSFDCGERKWLTNGAEISWKMP 98 >SB_59436| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 105 Score = 27.9 bits (59), Expect = 9.3 Identities = 11/24 (45%), Positives = 12/24 (50%) Frame = +3 Query: 132 YERCSYCNRRKWLTSGCLRKWIKP 203 Y R C RKWLT+G W P Sbjct: 75 YARSFDCGERKWLTNGAEISWKMP 98 >SB_59341| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 105 Score = 27.9 bits (59), Expect = 9.3 Identities = 11/24 (45%), Positives = 12/24 (50%) Frame = +3 Query: 132 YERCSYCNRRKWLTSGCLRKWIKP 203 Y R C RKWLT+G W P Sbjct: 75 YARSFDCGERKWLTNGAEISWKMP 98 >SB_59321| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 105 Score = 27.9 bits (59), Expect = 9.3 Identities = 11/24 (45%), Positives = 12/24 (50%) Frame = +3 Query: 132 YERCSYCNRRKWLTSGCLRKWIKP 203 Y R C RKWLT+G W P Sbjct: 75 YARSFDCGERKWLTNGAEISWKMP 98 >SB_59114| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 138 Score = 27.9 bits (59), Expect = 9.3 Identities = 11/24 (45%), Positives = 12/24 (50%) Frame = +3 Query: 132 YERCSYCNRRKWLTSGCLRKWIKP 203 Y R C RKWLT+G W P Sbjct: 108 YARSFDCGERKWLTNGAEISWKMP 131 >SB_58497| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 105 Score = 27.9 bits (59), Expect = 9.3 Identities = 11/24 (45%), Positives = 12/24 (50%) Frame = +3 Query: 132 YERCSYCNRRKWLTSGCLRKWIKP 203 Y R C RKWLT+G W P Sbjct: 75 YARSFDCGERKWLTNGAEISWKMP 98 >SB_58355| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 105 Score = 27.9 bits (59), Expect = 9.3 Identities = 11/24 (45%), Positives = 12/24 (50%) Frame = +3 Query: 132 YERCSYCNRRKWLTSGCLRKWIKP 203 Y R C RKWLT+G W P Sbjct: 75 YARSFDCGERKWLTNGAEISWKMP 98 >SB_58133| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 105 Score = 27.9 bits (59), Expect = 9.3 Identities = 11/24 (45%), Positives = 12/24 (50%) Frame = +3 Query: 132 YERCSYCNRRKWLTSGCLRKWIKP 203 Y R C RKWLT+G W P Sbjct: 75 YARSFDCGERKWLTNGAEISWKMP 98 >SB_57986| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 105 Score = 27.9 bits (59), Expect = 9.3 Identities = 11/24 (45%), Positives = 12/24 (50%) Frame = +3 Query: 132 YERCSYCNRRKWLTSGCLRKWIKP 203 Y R C RKWLT+G W P Sbjct: 75 YARSFDCGERKWLTNGAEISWKMP 98 >SB_57694| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 272 Score = 27.9 bits (59), Expect = 9.3 Identities = 11/24 (45%), Positives = 12/24 (50%) Frame = +3 Query: 132 YERCSYCNRRKWLTSGCLRKWIKP 203 Y R C RKWLT+G W P Sbjct: 242 YARSFDCGERKWLTNGAEISWKMP 265 >SB_57590| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 105 Score = 27.9 bits (59), Expect = 9.3 Identities = 11/24 (45%), Positives = 12/24 (50%) Frame = +3 Query: 132 YERCSYCNRRKWLTSGCLRKWIKP 203 Y R C RKWLT+G W P Sbjct: 75 YARSFDCGERKWLTNGAEISWKMP 98 >SB_57559| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 157 Score = 27.9 bits (59), Expect = 9.3 Identities = 11/24 (45%), Positives = 12/24 (50%) Frame = +3 Query: 132 YERCSYCNRRKWLTSGCLRKWIKP 203 Y R C RKWLT+G W P Sbjct: 127 YARSFDCGERKWLTNGAEISWKMP 150 >SB_57358| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 105 Score = 27.9 bits (59), Expect = 9.3 Identities = 11/24 (45%), Positives = 12/24 (50%) Frame = +3 Query: 132 YERCSYCNRRKWLTSGCLRKWIKP 203 Y R C RKWLT+G W P Sbjct: 75 YARSFDCGERKWLTNGAEISWKMP 98 >SB_57221| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 105 Score = 27.9 bits (59), Expect = 9.3 Identities = 11/24 (45%), Positives = 12/24 (50%) Frame = +3 Query: 132 YERCSYCNRRKWLTSGCLRKWIKP 203 Y R C RKWLT+G W P Sbjct: 75 YARSFDCGERKWLTNGAEISWKMP 98 >SB_56778| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 105 Score = 27.9 bits (59), Expect = 9.3 Identities = 11/24 (45%), Positives = 12/24 (50%) Frame = +3 Query: 132 YERCSYCNRRKWLTSGCLRKWIKP 203 Y R C RKWLT+G W P Sbjct: 75 YARSFDCGERKWLTNGAEISWKMP 98 >SB_56683| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 105 Score = 27.9 bits (59), Expect = 9.3 Identities = 11/24 (45%), Positives = 12/24 (50%) Frame = +3 Query: 132 YERCSYCNRRKWLTSGCLRKWIKP 203 Y R C RKWLT+G W P Sbjct: 75 YARSFDCGERKWLTNGAEISWKMP 98 >SB_56485| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 105 Score = 27.9 bits (59), Expect = 9.3 Identities = 11/24 (45%), Positives = 12/24 (50%) Frame = +3 Query: 132 YERCSYCNRRKWLTSGCLRKWIKP 203 Y R C RKWLT+G W P Sbjct: 75 YARSFDCGERKWLTNGAEISWKMP 98 >SB_56405| Best HMM Match : Fels1 (HMM E-Value=6.5) Length = 119 Score = 27.9 bits (59), Expect = 9.3 Identities = 11/24 (45%), Positives = 12/24 (50%) Frame = +3 Query: 132 YERCSYCNRRKWLTSGCLRKWIKP 203 Y R C RKWLT+G W P Sbjct: 89 YARSFDCGERKWLTNGAEISWKMP 112 >SB_56072| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1308 Score = 27.9 bits (59), Expect = 9.3 Identities = 11/24 (45%), Positives = 12/24 (50%) Frame = +3 Query: 132 YERCSYCNRRKWLTSGCLRKWIKP 203 Y R C RKWLT+G W P Sbjct: 110 YARSFDCGERKWLTNGAEISWKMP 133 >SB_55971| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 105 Score = 27.9 bits (59), Expect = 9.3 Identities = 11/24 (45%), Positives = 12/24 (50%) Frame = +3 Query: 132 YERCSYCNRRKWLTSGCLRKWIKP 203 Y R C RKWLT+G W P Sbjct: 75 YARSFDCGERKWLTNGAEISWKMP 98 >SB_55894| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 105 Score = 27.9 bits (59), Expect = 9.3 Identities = 11/24 (45%), Positives = 12/24 (50%) Frame = +3 Query: 132 YERCSYCNRRKWLTSGCLRKWIKP 203 Y R C RKWLT+G W P Sbjct: 75 YARSFDCGERKWLTNGAEISWKMP 98 >SB_55772| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 105 Score = 27.9 bits (59), Expect = 9.3 Identities = 11/24 (45%), Positives = 12/24 (50%) Frame = +3 Query: 132 YERCSYCNRRKWLTSGCLRKWIKP 203 Y R C RKWLT+G W P Sbjct: 75 YARSFDCGERKWLTNGAEISWKMP 98 >SB_55573| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 105 Score = 27.9 bits (59), Expect = 9.3 Identities = 11/24 (45%), Positives = 12/24 (50%) Frame = +3 Query: 132 YERCSYCNRRKWLTSGCLRKWIKP 203 Y R C RKWLT+G W P Sbjct: 75 YARSFDCGERKWLTNGAEISWKMP 98 >SB_55103| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 105 Score = 27.9 bits (59), Expect = 9.3 Identities = 11/24 (45%), Positives = 12/24 (50%) Frame = +3 Query: 132 YERCSYCNRRKWLTSGCLRKWIKP 203 Y R C RKWLT+G W P Sbjct: 75 YARSFDCGERKWLTNGAEISWKMP 98 >SB_55047| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 105 Score = 27.9 bits (59), Expect = 9.3 Identities = 11/24 (45%), Positives = 12/24 (50%) Frame = +3 Query: 132 YERCSYCNRRKWLTSGCLRKWIKP 203 Y R C RKWLT+G W P Sbjct: 75 YARSFDCGERKWLTNGAEISWKMP 98 >SB_54903| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 105 Score = 27.9 bits (59), Expect = 9.3 Identities = 11/24 (45%), Positives = 12/24 (50%) Frame = +3 Query: 132 YERCSYCNRRKWLTSGCLRKWIKP 203 Y R C RKWLT+G W P Sbjct: 75 YARSFDCGERKWLTNGAEISWKMP 98 >SB_54851| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 105 Score = 27.9 bits (59), Expect = 9.3 Identities = 11/24 (45%), Positives = 12/24 (50%) Frame = +3 Query: 132 YERCSYCNRRKWLTSGCLRKWIKP 203 Y R C RKWLT+G W P Sbjct: 75 YARSFDCGERKWLTNGAEISWKMP 98 >SB_54599| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 139 Score = 27.9 bits (59), Expect = 9.3 Identities = 11/24 (45%), Positives = 12/24 (50%) Frame = +3 Query: 132 YERCSYCNRRKWLTSGCLRKWIKP 203 Y R C RKWLT+G W P Sbjct: 109 YARSFDCGERKWLTNGAEISWKMP 132 >SB_54482| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 105 Score = 27.9 bits (59), Expect = 9.3 Identities = 11/24 (45%), Positives = 12/24 (50%) Frame = +3 Query: 132 YERCSYCNRRKWLTSGCLRKWIKP 203 Y R C RKWLT+G W P Sbjct: 75 YARSFDCGERKWLTNGAEISWKMP 98 >SB_54353| Best HMM Match : RuvB_C (HMM E-Value=3.6) Length = 141 Score = 27.9 bits (59), Expect = 9.3 Identities = 11/24 (45%), Positives = 12/24 (50%) Frame = +3 Query: 132 YERCSYCNRRKWLTSGCLRKWIKP 203 Y R C RKWLT+G W P Sbjct: 112 YARSFDCGERKWLTNGAEISWKMP 135 >SB_54325| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 682 Score = 27.9 bits (59), Expect = 9.3 Identities = 11/24 (45%), Positives = 12/24 (50%) Frame = +3 Query: 132 YERCSYCNRRKWLTSGCLRKWIKP 203 Y R C RKWLT+G W P Sbjct: 652 YARSFDCGERKWLTNGAEISWKMP 675 >SB_53936| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 136 Score = 27.9 bits (59), Expect = 9.3 Identities = 11/24 (45%), Positives = 12/24 (50%) Frame = +3 Query: 132 YERCSYCNRRKWLTSGCLRKWIKP 203 Y R C RKWLT+G W P Sbjct: 106 YARSFDCGERKWLTNGAEISWEMP 129 >SB_53836| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 105 Score = 27.9 bits (59), Expect = 9.3 Identities = 11/24 (45%), Positives = 12/24 (50%) Frame = +3 Query: 132 YERCSYCNRRKWLTSGCLRKWIKP 203 Y R C RKWLT+G W P Sbjct: 75 YARSFDCGERKWLTNGAEISWKMP 98 >SB_53698| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 122 Score = 27.9 bits (59), Expect = 9.3 Identities = 11/24 (45%), Positives = 12/24 (50%) Frame = +3 Query: 132 YERCSYCNRRKWLTSGCLRKWIKP 203 Y R C RKWLT+G W P Sbjct: 92 YARSFDCGERKWLTNGAEISWKMP 115 >SB_53493| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 105 Score = 27.9 bits (59), Expect = 9.3 Identities = 11/24 (45%), Positives = 12/24 (50%) Frame = +3 Query: 132 YERCSYCNRRKWLTSGCLRKWIKP 203 Y R C RKWLT+G W P Sbjct: 75 YARSFDCGERKWLTNGAEISWKMP 98 >SB_53207| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 105 Score = 27.9 bits (59), Expect = 9.3 Identities = 11/24 (45%), Positives = 12/24 (50%) Frame = +3 Query: 132 YERCSYCNRRKWLTSGCLRKWIKP 203 Y R C RKWLT+G W P Sbjct: 75 YARSFDCGERKWLTNGAEISWKMP 98 >SB_52948| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 105 Score = 27.9 bits (59), Expect = 9.3 Identities = 11/24 (45%), Positives = 12/24 (50%) Frame = +3 Query: 132 YERCSYCNRRKWLTSGCLRKWIKP 203 Y R C RKWLT+G W P Sbjct: 75 YARSFDCGERKWLTNGAEISWKMP 98 >SB_52761| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 105 Score = 27.9 bits (59), Expect = 9.3 Identities = 11/24 (45%), Positives = 12/24 (50%) Frame = +3 Query: 132 YERCSYCNRRKWLTSGCLRKWIKP 203 Y R C RKWLT+G W P Sbjct: 75 YARSFDCGERKWLTNGAEISWKMP 98 >SB_52662| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 105 Score = 27.9 bits (59), Expect = 9.3 Identities = 11/24 (45%), Positives = 12/24 (50%) Frame = +3 Query: 132 YERCSYCNRRKWLTSGCLRKWIKP 203 Y R C RKWLT+G W P Sbjct: 75 YARSFDCGERKWLTNGAEISWKMP 98 >SB_52635| Best HMM Match : THF_DHG_CYH_C (HMM E-Value=1.3) Length = 180 Score = 27.9 bits (59), Expect = 9.3 Identities = 11/24 (45%), Positives = 12/24 (50%) Frame = +3 Query: 132 YERCSYCNRRKWLTSGCLRKWIKP 203 Y R C RKWLT+G W P Sbjct: 150 YARSFDCGERKWLTNGAEISWKMP 173 >SB_52572| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 105 Score = 27.9 bits (59), Expect = 9.3 Identities = 11/24 (45%), Positives = 12/24 (50%) Frame = +3 Query: 132 YERCSYCNRRKWLTSGCLRKWIKP 203 Y R C RKWLT+G W P Sbjct: 75 YARSFDCGERKWLTNGAEISWKMP 98 >SB_52560| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1263 Score = 27.9 bits (59), Expect = 9.3 Identities = 11/24 (45%), Positives = 12/24 (50%) Frame = +3 Query: 132 YERCSYCNRRKWLTSGCLRKWIKP 203 Y R C RKWLT+G W P Sbjct: 461 YARSFDCGERKWLTNGAEISWKMP 484 >SB_52557| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 122 Score = 27.9 bits (59), Expect = 9.3 Identities = 11/24 (45%), Positives = 12/24 (50%) Frame = +3 Query: 132 YERCSYCNRRKWLTSGCLRKWIKP 203 Y R C RKWLT+G W P Sbjct: 92 YARSFDCGERKWLTNGAEISWKMP 115 >SB_51972| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 105 Score = 27.9 bits (59), Expect = 9.3 Identities = 11/24 (45%), Positives = 12/24 (50%) Frame = +3 Query: 132 YERCSYCNRRKWLTSGCLRKWIKP 203 Y R C RKWLT+G W P Sbjct: 75 YARSFDCGERKWLTNGAEISWKMP 98 >SB_51882| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 105 Score = 27.9 bits (59), Expect = 9.3 Identities = 11/24 (45%), Positives = 12/24 (50%) Frame = +3 Query: 132 YERCSYCNRRKWLTSGCLRKWIKP 203 Y R C RKWLT+G W P Sbjct: 75 YARSFDCGERKWLTNGAEISWKMP 98 >SB_51647| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 105 Score = 27.9 bits (59), Expect = 9.3 Identities = 11/24 (45%), Positives = 12/24 (50%) Frame = +3 Query: 132 YERCSYCNRRKWLTSGCLRKWIKP 203 Y R C RKWLT+G W P Sbjct: 75 YARSFDCGERKWLTNGAEISWKMP 98 >SB_51566| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 105 Score = 27.9 bits (59), Expect = 9.3 Identities = 11/24 (45%), Positives = 12/24 (50%) Frame = +3 Query: 132 YERCSYCNRRKWLTSGCLRKWIKP 203 Y R C RKWLT+G W P Sbjct: 75 YARSFDCGERKWLTNGAEISWKMP 98 >SB_51213| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 27.9 bits (59), Expect = 9.3 Identities = 11/24 (45%), Positives = 12/24 (50%) Frame = +3 Query: 132 YERCSYCNRRKWLTSGCLRKWIKP 203 Y R C RKWLT+G W P Sbjct: 90 YARSFDCGERKWLTNGAEISWKMP 113 >SB_51064| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 197 Score = 27.9 bits (59), Expect = 9.3 Identities = 11/24 (45%), Positives = 12/24 (50%) Frame = +3 Query: 132 YERCSYCNRRKWLTSGCLRKWIKP 203 Y R C RKWLT+G W P Sbjct: 92 YARSFDCGERKWLTNGAEISWKMP 115 >SB_50537| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 105 Score = 27.9 bits (59), Expect = 9.3 Identities = 11/24 (45%), Positives = 12/24 (50%) Frame = +3 Query: 132 YERCSYCNRRKWLTSGCLRKWIKP 203 Y R C RKWLT+G W P Sbjct: 75 YARSFDCGERKWLTNGAEISWKMP 98 >SB_50527| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 137 Score = 27.9 bits (59), Expect = 9.3 Identities = 11/24 (45%), Positives = 12/24 (50%) Frame = +3 Query: 132 YERCSYCNRRKWLTSGCLRKWIKP 203 Y R C RKWLT+G W P Sbjct: 107 YARSFDCGERKWLTNGAEISWKMP 130 >SB_50288| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 105 Score = 27.9 bits (59), Expect = 9.3 Identities = 11/24 (45%), Positives = 12/24 (50%) Frame = +3 Query: 132 YERCSYCNRRKWLTSGCLRKWIKP 203 Y R C RKWLT+G W P Sbjct: 75 YARSFDCGERKWLTNGAEISWKMP 98 >SB_49737| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 105 Score = 27.9 bits (59), Expect = 9.3 Identities = 11/24 (45%), Positives = 12/24 (50%) Frame = +3 Query: 132 YERCSYCNRRKWLTSGCLRKWIKP 203 Y R C RKWLT+G W P Sbjct: 75 YARSFDCGERKWLTNGAEISWKMP 98 >SB_49720| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 105 Score = 27.9 bits (59), Expect = 9.3 Identities = 11/24 (45%), Positives = 12/24 (50%) Frame = +3 Query: 132 YERCSYCNRRKWLTSGCLRKWIKP 203 Y R C RKWLT+G W P Sbjct: 75 YARSFDCGERKWLTNGAEISWKMP 98 >SB_49124| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 153 Score = 27.9 bits (59), Expect = 9.3 Identities = 11/24 (45%), Positives = 12/24 (50%) Frame = +3 Query: 132 YERCSYCNRRKWLTSGCLRKWIKP 203 Y R C RKWLT+G W P Sbjct: 123 YARSFDCGERKWLTNGAEISWKMP 146 >SB_48785| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 105 Score = 27.9 bits (59), Expect = 9.3 Identities = 11/24 (45%), Positives = 12/24 (50%) Frame = +3 Query: 132 YERCSYCNRRKWLTSGCLRKWIKP 203 Y R C RKWLT+G W P Sbjct: 75 YARSFDCGERKWLTNGAEISWKMP 98 >SB_48664| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 197 Score = 27.9 bits (59), Expect = 9.3 Identities = 11/24 (45%), Positives = 12/24 (50%) Frame = +3 Query: 132 YERCSYCNRRKWLTSGCLRKWIKP 203 Y R C RKWLT+G W P Sbjct: 167 YARSFDCGERKWLTNGAEISWKMP 190 >SB_48482| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 122 Score = 27.9 bits (59), Expect = 9.3 Identities = 11/24 (45%), Positives = 12/24 (50%) Frame = +3 Query: 132 YERCSYCNRRKWLTSGCLRKWIKP 203 Y R C RKWLT+G W P Sbjct: 92 YARSFDCGERKWLTNGAEISWKMP 115 >SB_47984| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 231 Score = 27.9 bits (59), Expect = 9.3 Identities = 11/24 (45%), Positives = 12/24 (50%) Frame = +3 Query: 132 YERCSYCNRRKWLTSGCLRKWIKP 203 Y R C RKWLT+G W P Sbjct: 201 YARSFDCGERKWLTNGAEISWKMP 224 >SB_47738| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 137 Score = 27.9 bits (59), Expect = 9.3 Identities = 11/24 (45%), Positives = 12/24 (50%) Frame = +3 Query: 132 YERCSYCNRRKWLTSGCLRKWIKP 203 Y R C RKWLT+G W P Sbjct: 107 YARSFDCGERKWLTNGAEISWKMP 130 >SB_47507| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 917 Score = 27.9 bits (59), Expect = 9.3 Identities = 11/24 (45%), Positives = 12/24 (50%) Frame = +3 Query: 132 YERCSYCNRRKWLTSGCLRKWIKP 203 Y R C RKWLT+G W P Sbjct: 92 YARSFDCGERKWLTNGAEISWKMP 115 >SB_47297| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 105 Score = 27.9 bits (59), Expect = 9.3 Identities = 11/24 (45%), Positives = 12/24 (50%) Frame = +3 Query: 132 YERCSYCNRRKWLTSGCLRKWIKP 203 Y R C RKWLT+G W P Sbjct: 75 YARSFDCGERKWLTNGAEISWKMP 98 >SB_47238| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 123 Score = 27.9 bits (59), Expect = 9.3 Identities = 11/24 (45%), Positives = 12/24 (50%) Frame = +3 Query: 132 YERCSYCNRRKWLTSGCLRKWIKP 203 Y R C RKWLT+G W P Sbjct: 93 YARSFDCGERKWLTNGAEISWKMP 116 >SB_46711| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 105 Score = 27.9 bits (59), Expect = 9.3 Identities = 11/24 (45%), Positives = 12/24 (50%) Frame = +3 Query: 132 YERCSYCNRRKWLTSGCLRKWIKP 203 Y R C RKWLT+G W P Sbjct: 75 YARSFDCGERKWLTNGAEISWKMP 98 >SB_46709| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 176 Score = 27.9 bits (59), Expect = 9.3 Identities = 11/24 (45%), Positives = 12/24 (50%) Frame = +3 Query: 132 YERCSYCNRRKWLTSGCLRKWIKP 203 Y R C RKWLT+G W P Sbjct: 146 YARSFDCGERKWLTNGAEISWKMP 169 >SB_46514| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 105 Score = 27.9 bits (59), Expect = 9.3 Identities = 11/24 (45%), Positives = 12/24 (50%) Frame = +3 Query: 132 YERCSYCNRRKWLTSGCLRKWIKP 203 Y R C RKWLT+G W P Sbjct: 75 YARSFDCGERKWLTNGAEISWKMP 98 >SB_46370| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 204 Score = 27.9 bits (59), Expect = 9.3 Identities = 11/24 (45%), Positives = 12/24 (50%) Frame = +3 Query: 132 YERCSYCNRRKWLTSGCLRKWIKP 203 Y R C RKWLT+G W P Sbjct: 174 YARSFDCGERKWLTNGAEISWKMP 197 >SB_46352| Best HMM Match : L71 (HMM E-Value=0.19) Length = 179 Score = 27.9 bits (59), Expect = 9.3 Identities = 11/24 (45%), Positives = 12/24 (50%) Frame = +3 Query: 132 YERCSYCNRRKWLTSGCLRKWIKP 203 Y R C RKWLT+G W P Sbjct: 149 YARSFDCGERKWLTNGAEISWKMP 172 >SB_46282| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 105 Score = 27.9 bits (59), Expect = 9.3 Identities = 11/24 (45%), Positives = 12/24 (50%) Frame = +3 Query: 132 YERCSYCNRRKWLTSGCLRKWIKP 203 Y R C RKWLT+G W P Sbjct: 75 YARSFDCGERKWLTNGAEISWKMP 98 >SB_46221| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 105 Score = 27.9 bits (59), Expect = 9.3 Identities = 11/24 (45%), Positives = 12/24 (50%) Frame = +3 Query: 132 YERCSYCNRRKWLTSGCLRKWIKP 203 Y R C RKWLT+G W P Sbjct: 75 YARSFDCGERKWLTNGAEISWKMP 98 >SB_45973| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 105 Score = 27.9 bits (59), Expect = 9.3 Identities = 11/24 (45%), Positives = 12/24 (50%) Frame = +3 Query: 132 YERCSYCNRRKWLTSGCLRKWIKP 203 Y R C RKWLT+G W P Sbjct: 75 YARSFDCGERKWLTNGAEISWKMP 98 >SB_45953| Best HMM Match : LRR_1 (HMM E-Value=7.4e-15) Length = 1427 Score = 27.9 bits (59), Expect = 9.3 Identities = 11/24 (45%), Positives = 12/24 (50%) Frame = +3 Query: 132 YERCSYCNRRKWLTSGCLRKWIKP 203 Y R C RKWLT+G W P Sbjct: 1397 YARSFDCGERKWLTNGAEISWKMP 1420 >SB_45744| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 105 Score = 27.9 bits (59), Expect = 9.3 Identities = 11/24 (45%), Positives = 12/24 (50%) Frame = +3 Query: 132 YERCSYCNRRKWLTSGCLRKWIKP 203 Y R C RKWLT+G W P Sbjct: 75 YARSFDCGERKWLTNGAEISWKMP 98 >SB_45699| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 173 Score = 27.9 bits (59), Expect = 9.3 Identities = 11/24 (45%), Positives = 12/24 (50%) Frame = +3 Query: 132 YERCSYCNRRKWLTSGCLRKWIKP 203 Y R C RKWLT+G W P Sbjct: 143 YARSFDCGERKWLTNGAEISWKMP 166 >SB_45621| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 105 Score = 27.9 bits (59), Expect = 9.3 Identities = 11/24 (45%), Positives = 12/24 (50%) Frame = +3 Query: 132 YERCSYCNRRKWLTSGCLRKWIKP 203 Y R C RKWLT+G W P Sbjct: 75 YARSFDCGERKWLTNGAEISWKMP 98 >SB_45526| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 187 Score = 27.9 bits (59), Expect = 9.3 Identities = 11/24 (45%), Positives = 12/24 (50%) Frame = +3 Query: 132 YERCSYCNRRKWLTSGCLRKWIKP 203 Y R C RKWLT+G W P Sbjct: 157 YARSFDCGERKWLTNGAEISWKMP 180 >SB_45393| Best HMM Match : Pkinase_Tyr (HMM E-Value=0.088) Length = 488 Score = 27.9 bits (59), Expect = 9.3 Identities = 11/24 (45%), Positives = 12/24 (50%) Frame = +3 Query: 132 YERCSYCNRRKWLTSGCLRKWIKP 203 Y R C RKWLT+G W P Sbjct: 458 YARSFDCGERKWLTNGAEISWEMP 481 >SB_45253| Best HMM Match : ig (HMM E-Value=0.00016) Length = 678 Score = 27.9 bits (59), Expect = 9.3 Identities = 11/24 (45%), Positives = 12/24 (50%) Frame = +3 Query: 132 YERCSYCNRRKWLTSGCLRKWIKP 203 Y R C RKWLT+G W P Sbjct: 211 YARSFDCGERKWLTNGAEISWKMP 234 >SB_45037| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 105 Score = 27.9 bits (59), Expect = 9.3 Identities = 11/24 (45%), Positives = 12/24 (50%) Frame = +3 Query: 132 YERCSYCNRRKWLTSGCLRKWIKP 203 Y R C RKWLT+G W P Sbjct: 75 YARSFDCGERKWLTNGAEISWKMP 98 >SB_44899| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 105 Score = 27.9 bits (59), Expect = 9.3 Identities = 11/24 (45%), Positives = 12/24 (50%) Frame = +3 Query: 132 YERCSYCNRRKWLTSGCLRKWIKP 203 Y R C RKWLT+G W P Sbjct: 75 YARSFDCGERKWLTNGAEISWKMP 98 >SB_44811| Best HMM Match : Toxin_33 (HMM E-Value=8.1) Length = 142 Score = 27.9 bits (59), Expect = 9.3 Identities = 11/24 (45%), Positives = 12/24 (50%) Frame = +3 Query: 132 YERCSYCNRRKWLTSGCLRKWIKP 203 Y R C RKWLT+G W P Sbjct: 112 YARSFDCGERKWLTNGAEISWKMP 135 >SB_44593| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 105 Score = 27.9 bits (59), Expect = 9.3 Identities = 11/24 (45%), Positives = 12/24 (50%) Frame = +3 Query: 132 YERCSYCNRRKWLTSGCLRKWIKP 203 Y R C RKWLT+G W P Sbjct: 75 YARSFDCGERKWLTNGAEISWKMP 98 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 21,923,446 Number of Sequences: 59808 Number of extensions: 447311 Number of successful extensions: 1750 Number of sequences better than 10.0: 500 Number of HSP's better than 10.0 without gapping: 1646 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1750 length of database: 16,821,457 effective HSP length: 80 effective length of database: 12,036,817 effective search space used: 2034222073 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -