BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= brP-0191 (784 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AB204559-1|BAD89804.1| 832|Apis mellifera soluble guanylyl cycl... 28 0.11 AY769960-1|AAV34676.1| 603|Apis mellifera soluble guanylyl cycl... 22 5.6 AB181489-1|BAD22772.1| 603|Apis mellifera soluble guanylyl cycl... 22 5.6 EF540769-1|ABQ14707.1| 620|Apis mellifera adenosine deaminase p... 22 7.4 >AB204559-1|BAD89804.1| 832|Apis mellifera soluble guanylyl cyclase beta-3 protein. Length = 832 Score = 27.9 bits (59), Expect = 0.11 Identities = 15/43 (34%), Positives = 24/43 (55%), Gaps = 3/43 (6%) Frame = -2 Query: 228 IGVVGELGRPFY---ILLDAVDDMHVLDLHHVTFQFVFS*RAF 109 +G + E+ R FY + ++ V + + D HVTF+ F RAF Sbjct: 145 MGQIREVARHFYHKELQIELVREEILFDTVHVTFKLTFDNRAF 187 >AY769960-1|AAV34676.1| 603|Apis mellifera soluble guanylyl cyclase beta 1 subunit protein. Length = 603 Score = 22.2 bits (45), Expect = 5.6 Identities = 10/29 (34%), Positives = 15/29 (51%) Frame = +1 Query: 316 YAIAYNCKYDDKKKSHQVFVWILSRNKKL 402 + + Y K KS + VW LSR ++L Sbjct: 573 FLLEYRGPVTMKGKSEPMNVWFLSREREL 601 >AB181489-1|BAD22772.1| 603|Apis mellifera soluble guanylyl cyclase beta 1 subunit protein. Length = 603 Score = 22.2 bits (45), Expect = 5.6 Identities = 10/29 (34%), Positives = 15/29 (51%) Frame = +1 Query: 316 YAIAYNCKYDDKKKSHQVFVWILSRNKKL 402 + + Y K KS + VW LSR ++L Sbjct: 573 FLLEYRGPVTMKGKSEPMNVWFLSREREL 601 >EF540769-1|ABQ14707.1| 620|Apis mellifera adenosine deaminase protein. Length = 620 Score = 21.8 bits (44), Expect = 7.4 Identities = 11/26 (42%), Positives = 14/26 (53%) Frame = +2 Query: 407 ATLKLLSIISSRNTPKR*TLRNLCIP 484 A L L +I+ RNTP+ N C P Sbjct: 90 AELALRNIVQFRNTPEVHQAINTCQP 115 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 184,098 Number of Sequences: 438 Number of extensions: 3936 Number of successful extensions: 6 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 6 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 6 length of database: 146,343 effective HSP length: 57 effective length of database: 121,377 effective search space used: 24639531 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -