BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= brP-0190 (760 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPBC16D10.05 |mok13||alpha-1,3-glucan synthase Mok13|Schizosacch... 29 0.54 SPAC15A10.11 |ubr11||N-end-recognizing protein |Schizosaccharomy... 26 5.1 >SPBC16D10.05 |mok13||alpha-1,3-glucan synthase Mok13|Schizosaccharomyces pombe|chr 2|||Manual Length = 2358 Score = 29.5 bits (63), Expect = 0.54 Identities = 18/63 (28%), Positives = 33/63 (52%), Gaps = 3/63 (4%) Frame = -3 Query: 272 LAAFICASFLVVEFPAPKYENPSTRTSHRKR-WR--CLGPVARISKSGVKPFLAHQVYKN 102 ++ ICA ++ F Y+ + +K+ W+ LGP +RIS+S + +HQV N Sbjct: 1067 VSPLICALATMLAFQKFFYQVRLNKGIEKKQEWKEKLLGPFSRISQSNINQGFSHQVALN 1126 Query: 101 DLI 93 + + Sbjct: 1127 NSV 1129 >SPAC15A10.11 |ubr11||N-end-recognizing protein |Schizosaccharomyces pombe|chr 1|||Manual Length = 2052 Score = 26.2 bits (55), Expect = 5.1 Identities = 9/23 (39%), Positives = 17/23 (73%) Frame = -3 Query: 128 FLAHQVYKNDLISILSRYFGRYS 60 ++A +Y+ND+ + LS Y+ +YS Sbjct: 1441 YVARSMYRNDVTAGLSEYYYKYS 1463 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,594,515 Number of Sequences: 5004 Number of extensions: 44722 Number of successful extensions: 92 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 89 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 92 length of database: 2,362,478 effective HSP length: 71 effective length of database: 2,007,194 effective search space used: 363302114 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -