BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= brP-0190 (760 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_4771| Best HMM Match : DEAD (HMM E-Value=0.015) 62 5e-10 SB_28728| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 2e-06 SB_36408| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 8e-06 SB_29769| Best HMM Match : TNFR_c6 (HMM E-Value=3.60001e-40) 43 3e-04 SB_5500| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 3e-04 SB_17217| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.001 SB_33025| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.002 SB_29084| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.005 SB_27779| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.005 SB_45900| Best HMM Match : Chordopox_A13L (HMM E-Value=7.4) 39 0.005 SB_43339| Best HMM Match : SAC3_GANP (HMM E-Value=1.8e-09) 39 0.005 SB_11176| Best HMM Match : PTS_EIIB (HMM E-Value=4.4) 38 0.007 SB_42069| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.009 SB_38675| Best HMM Match : HEAT (HMM E-Value=0.0016) 38 0.009 SB_2468| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.009 SB_51296| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.009 SB_37693| Best HMM Match : PHD (HMM E-Value=8.7e-35) 38 0.009 SB_35835| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.009 SB_19310| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.009 SB_11962| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.009 SB_10099| Best HMM Match : Neur_chan_LBD (HMM E-Value=3.6e-17) 38 0.009 SB_59802| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.012 SB_59119| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.012 SB_58967| Best HMM Match : Sec23_BS (HMM E-Value=5.9) 38 0.012 SB_58852| Best HMM Match : Hormone_4 (HMM E-Value=2.8) 38 0.012 SB_58792| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.012 SB_58713| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.012 SB_58195| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.012 SB_58029| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.012 SB_56603| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.012 SB_56369| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.012 SB_55830| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.012 SB_55579| Best HMM Match : Rhodanese (HMM E-Value=9.2e-29) 38 0.012 SB_54985| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.012 SB_54503| Best HMM Match : DUF753 (HMM E-Value=4.7) 38 0.012 SB_53675| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.012 SB_53669| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.012 SB_53077| Best HMM Match : SRP54_N (HMM E-Value=1.8) 38 0.012 SB_52837| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.012 SB_51967| Best HMM Match : Wzy_C (HMM E-Value=7.3) 38 0.012 SB_50928| Best HMM Match : 7tm_2 (HMM E-Value=4.7e-07) 38 0.012 SB_50489| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.012 SB_50209| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.012 SB_50159| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.012 SB_50054| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.012 SB_49806| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.012 SB_48895| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.012 SB_48422| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.012 SB_47991| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.012 SB_47859| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.012 SB_47433| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.012 SB_47291| Best HMM Match : PilN (HMM E-Value=0.75) 38 0.012 SB_46080| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.012 SB_45570| Best HMM Match : Euplotes_phero (HMM E-Value=2.6) 38 0.012 SB_45449| Best HMM Match : Glyco_hydro_47 (HMM E-Value=1.4e-07) 38 0.012 SB_45437| Best HMM Match : Ribosomal_L15e (HMM E-Value=0.53) 38 0.012 SB_43819| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.012 SB_42949| Best HMM Match : SRCR (HMM E-Value=1.6e-14) 38 0.012 SB_42593| Best HMM Match : Rho_GDI (HMM E-Value=3.7e-17) 38 0.012 SB_42373| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.012 SB_42112| Best HMM Match : Herpes_UL49_2 (HMM E-Value=1.5) 38 0.012 SB_41202| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.012 SB_41136| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.012 SB_41068| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.012 SB_40980| Best HMM Match : ANF_receptor (HMM E-Value=0.00014) 38 0.012 SB_40764| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.012 SB_40601| Best HMM Match : VWA_CoxE (HMM E-Value=6.3) 38 0.012 SB_40576| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.012 SB_40463| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.012 SB_40182| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.012 SB_40068| Best HMM Match : Pkinase_Tyr (HMM E-Value=0) 38 0.012 SB_40003| Best HMM Match : YTV (HMM E-Value=8.9) 38 0.012 SB_39444| Best HMM Match : SAC3_GANP (HMM E-Value=0.68) 38 0.012 SB_38813| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.012 SB_38774| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.012 SB_38425| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.012 SB_38203| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.012 SB_38016| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.012 SB_37771| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.012 SB_36681| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.012 SB_36207| Best HMM Match : 7kD_coat (HMM E-Value=7.6) 38 0.012 SB_36014| Best HMM Match : DUF437 (HMM E-Value=6.4) 38 0.012 SB_35849| Best HMM Match : Fibrinogen_C (HMM E-Value=0.15) 38 0.012 SB_35317| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.012 SB_35151| Best HMM Match : DUF589 (HMM E-Value=7.5) 38 0.012 SB_34685| Best HMM Match : RNA_pol_A_bac (HMM E-Value=1.8) 38 0.012 SB_34478| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.012 SB_31889| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.012 SB_31511| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.012 SB_30142| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.012 SB_29521| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.012 SB_29043| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.012 SB_28650| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.012 SB_28487| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.012 SB_28424| Best HMM Match : SAM_1 (HMM E-Value=8e-06) 38 0.012 SB_28245| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.012 SB_27897| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.012 SB_27137| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.012 SB_27095| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.012 SB_27010| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.012 SB_26995| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.012 SB_26954| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.012 SB_26672| Best HMM Match : Exo_endo_phos (HMM E-Value=0.46) 38 0.012 SB_26607| Best HMM Match : K_tetra (HMM E-Value=3.3e-08) 38 0.012 SB_25727| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.012 SB_25469| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.012 SB_25193| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.012 SB_24322| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.012 SB_23294| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.012 SB_23196| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.012 SB_23195| Best HMM Match : zf-C3HC4 (HMM E-Value=1.3e-10) 38 0.012 SB_22108| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.012 SB_21853| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.012 SB_21523| Best HMM Match : Pkinase (HMM E-Value=9.5e-14) 38 0.012 SB_20900| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.012 SB_20847| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.012 SB_20814| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.012 SB_20629| Best HMM Match : WD40 (HMM E-Value=0.0014) 38 0.012 SB_18983| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.012 SB_18796| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.012 SB_18538| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.012 SB_18411| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.012 SB_18318| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.012 SB_18158| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.012 SB_17237| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.012 SB_15873| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.012 SB_15818| Best HMM Match : Apo-VLDL-II (HMM E-Value=1.2) 38 0.012 SB_15447| Best HMM Match : C1_1 (HMM E-Value=0.11) 38 0.012 SB_15375| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.012 SB_14672| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.012 SB_14518| Best HMM Match : MIB_HERC2 (HMM E-Value=2.4e-38) 38 0.012 SB_14175| Best HMM Match : GBP_repeat (HMM E-Value=3.8) 38 0.012 SB_14044| Best HMM Match : EGF_CA (HMM E-Value=4.1e-13) 38 0.012 SB_13919| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.012 SB_13475| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.012 SB_13295| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.012 SB_13049| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.012 SB_12559| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.012 SB_12016| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.012 SB_11991| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.012 SB_11294| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.012 SB_10976| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.012 SB_10247| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.012 SB_9391| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.012 SB_9055| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.012 SB_8565| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.012 SB_8424| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.012 SB_8222| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.012 SB_8126| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.012 SB_7849| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.012 SB_7261| Best HMM Match : RHS (HMM E-Value=5.3) 38 0.012 SB_7005| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.012 SB_6796| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.012 SB_6339| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.012 SB_6047| Best HMM Match : CXC (HMM E-Value=7.7) 38 0.012 SB_5753| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.012 SB_5503| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.012 SB_5427| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.012 SB_4286| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.012 SB_4268| Best HMM Match : MtrG (HMM E-Value=1.2) 38 0.012 SB_4192| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.012 SB_3720| Best HMM Match : RVT_1 (HMM E-Value=0.0031) 38 0.012 SB_3671| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.012 SB_2384| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.012 SB_1609| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.012 SB_751| Best HMM Match : rve (HMM E-Value=7.5e-12) 38 0.012 SB_266| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.012 SB_59| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.012 SB_58440| Best HMM Match : Ribosomal_L9_C (HMM E-Value=0.81) 38 0.012 SB_58394| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.012 SB_57506| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.012 SB_57021| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.012 SB_56970| Best HMM Match : Thaumatin (HMM E-Value=5.4) 38 0.012 SB_56955| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.012 SB_56767| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.012 SB_56729| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.012 SB_56672| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.012 SB_56555| Best HMM Match : 7tm_1 (HMM E-Value=4.4) 38 0.012 SB_56358| Best HMM Match : Fork_head (HMM E-Value=1.2e-30) 38 0.012 SB_56099| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.012 SB_56058| Best HMM Match : Phasin (HMM E-Value=2.7) 38 0.012 SB_55954| Best HMM Match : TIL (HMM E-Value=0.74) 38 0.012 SB_55182| Best HMM Match : T4_deiodinase (HMM E-Value=0) 38 0.012 SB_55138| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.012 SB_55112| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.012 SB_54421| Best HMM Match : HipA_C (HMM E-Value=7.5) 38 0.012 SB_54343| Best HMM Match : TipAS (HMM E-Value=0.77) 38 0.012 SB_54153| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.012 SB_54005| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.012 SB_53974| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.012 SB_53662| Best HMM Match : Protamine_P2 (HMM E-Value=9.2) 38 0.012 SB_53598| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.012 SB_53044| Best HMM Match : TcpA (HMM E-Value=3.1) 38 0.012 SB_52956| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.012 SB_52523| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.012 SB_51739| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.012 SB_51732| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.012 SB_51109| Best HMM Match : ATP-cone (HMM E-Value=0.76) 38 0.012 SB_50972| Best HMM Match : MH1 (HMM E-Value=7.1) 38 0.012 SB_50818| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.012 SB_50491| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.012 SB_50286| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.012 SB_50222| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.012 SB_50081| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.012 SB_50019| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.012 SB_49981| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.012 SB_49899| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.012 SB_49895| Best HMM Match : NACHT (HMM E-Value=7.7) 38 0.012 SB_49629| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.012 SB_48632| Best HMM Match : DUF265 (HMM E-Value=7.6e-22) 38 0.012 SB_47940| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.012 SB_47474| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.012 SB_47304| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.012 SB_47265| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.012 SB_47031| Best HMM Match : Protamine_P1 (HMM E-Value=7) 38 0.012 SB_46830| Best HMM Match : Succ_DH_flav_C (HMM E-Value=3.2e-37) 38 0.012 SB_46484| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.012 SB_46118| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.012 SB_45749| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.012 SB_45575| Best HMM Match : Keratin_B2 (HMM E-Value=8.8) 38 0.012 SB_45266| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.012 SB_44239| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.012 SB_44171| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.012 SB_44073| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.012 SB_43825| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.012 SB_43752| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.012 SB_43722| Best HMM Match : TPR_4 (HMM E-Value=0.69) 38 0.012 SB_42847| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.012 SB_42555| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.012 SB_42300| Best HMM Match : Filament_head (HMM E-Value=4.9) 38 0.012 SB_42133| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.012 SB_42128| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.012 SB_41545| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.012 SB_41358| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.012 SB_41085| Best HMM Match : Auxin_repressed (HMM E-Value=9) 38 0.012 SB_40884| Best HMM Match : Homeobox (HMM E-Value=0.068) 38 0.012 SB_40300| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.012 SB_40139| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.012 SB_39508| Best HMM Match : F5_F8_type_C (HMM E-Value=0) 38 0.012 SB_39391| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.012 SB_39208| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.012 SB_38658| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.012 SB_38558| Best HMM Match : TFIIA_gamma_N (HMM E-Value=7.4) 38 0.012 SB_38521| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.012 SB_38282| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.012 SB_38080| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.012 SB_37703| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.012 SB_37072| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.012 SB_36830| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.012 SB_36723| Best HMM Match : DUF753 (HMM E-Value=9.9) 38 0.012 SB_36604| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.012 SB_36598| Best HMM Match : E-MAP-115 (HMM E-Value=0.092) 38 0.012 SB_36396| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.012 SB_36374| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.012 SB_35614| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.012 SB_35131| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.012 SB_34873| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.012 SB_34844| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.012 SB_34424| Best HMM Match : RNase_U2 (HMM E-Value=7.5) 38 0.012 SB_34216| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.012 SB_34007| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.012 SB_33833| Best HMM Match : DUF947 (HMM E-Value=0.2) 38 0.012 SB_33422| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.012 SB_33231| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.012 SB_32900| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.012 SB_32024| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.012 SB_31980| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.012 SB_31865| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.012 SB_31592| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.012 SB_31481| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.012 SB_31350| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.012 SB_31293| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.012 SB_30835| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.012 SB_30699| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.012 SB_30521| Best HMM Match : DUF333 (HMM E-Value=9.4) 38 0.012 SB_30479| Best HMM Match : WD40 (HMM E-Value=1.1e-06) 38 0.012 SB_30218| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.012 SB_29851| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.012 SB_29553| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.012 SB_29464| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.012 SB_29409| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.012 SB_29177| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.012 SB_29145| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.012 SB_28808| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.012 SB_28480| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.012 SB_26038| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.012 SB_25820| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.012 SB_25742| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.012 SB_25673| Best HMM Match : MFS_1 (HMM E-Value=0.18) 38 0.012 SB_25630| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.012 SB_24724| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.012 SB_24684| Best HMM Match : Phage_rep_O (HMM E-Value=2.3) 38 0.012 SB_24127| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.012 SB_24102| Best HMM Match : DUF753 (HMM E-Value=9.4) 38 0.012 SB_23875| Best HMM Match : Porin_3 (HMM E-Value=3.22299e-44) 38 0.012 SB_23282| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.012 SB_22993| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.012 SB_22914| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.012 SB_21520| Best HMM Match : Trypsin (HMM E-Value=0) 38 0.012 SB_21177| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.012 SB_20904| Best HMM Match : Filament_head (HMM E-Value=10) 38 0.012 SB_20277| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.012 SB_20097| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.012 SB_19885| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.012 SB_19009| Best HMM Match : Sperm_Ag_HE2 (HMM E-Value=2.3) 38 0.012 SB_18235| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.012 SB_17919| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.012 SB_17265| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.012 SB_17049| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.012 SB_16846| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.012 SB_16672| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.012 SB_16494| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.012 SB_16270| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.012 SB_16198| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.012 SB_16182| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.012 SB_15972| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.012 SB_15539| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.012 SB_14857| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.012 SB_14581| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.012 SB_14087| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.012 SB_13215| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.012 SB_12828| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.012 SB_12580| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.012 SB_12518| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.012 SB_12140| Best HMM Match : ATP-synt_F (HMM E-Value=0.21) 38 0.012 SB_12114| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.012 SB_11401| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.012 SB_11228| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.012 SB_11209| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.012 SB_11018| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.012 SB_10984| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.012 SB_10689| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.012 SB_10523| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.012 SB_10150| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.012 SB_9428| Best HMM Match : Vicilin_N (HMM E-Value=4.2) 38 0.012 SB_9250| Best HMM Match : BAG (HMM E-Value=6.2) 38 0.012 SB_9090| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.012 SB_8817| Best HMM Match : I-set (HMM E-Value=0) 38 0.012 SB_8429| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.012 SB_7769| Best HMM Match : Histone (HMM E-Value=0.2) 38 0.012 SB_7590| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.012 SB_7267| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.012 SB_6665| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.012 SB_6263| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.012 SB_5632| Best HMM Match : XRN_N (HMM E-Value=3.9) 38 0.012 SB_5073| Best HMM Match : Rhomboid (HMM E-Value=3.3) 38 0.012 SB_4702| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.012 SB_4674| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.012 SB_4528| Best HMM Match : Antistasin (HMM E-Value=8.4) 38 0.012 SB_4508| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.012 SB_4402| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.012 SB_4342| Best HMM Match : KA1 (HMM E-Value=0.53) 38 0.012 SB_2432| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.012 SB_2348| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.012 SB_2263| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.012 SB_1977| Best HMM Match : Filament_head (HMM E-Value=4.2) 38 0.012 SB_1945| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.012 SB_1808| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.012 SB_1435| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.012 SB_1403| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.012 SB_1283| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.012 SB_1210| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.012 SB_1178| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.012 SB_1099| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.012 SB_938| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.012 SB_758| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.012 SB_357| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.012 SB_59624| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.015 SB_58723| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.015 SB_58076| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.015 SB_57885| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.015 SB_57829| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.015 SB_57692| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.015 SB_57259| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.015 SB_56880| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.015 SB_56660| Best HMM Match : zf-C2H2 (HMM E-Value=0) 37 0.015 SB_56642| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.015 SB_55921| Best HMM Match : Aldo_ket_red (HMM E-Value=0.16) 37 0.015 SB_55719| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.015 SB_55703| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.015 SB_55592| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.015 SB_55192| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.015 SB_53462| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.015 SB_53366| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.015 SB_52265| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.015 SB_52130| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.015 SB_52085| Best HMM Match : TIL (HMM E-Value=2.5) 37 0.015 SB_51638| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.015 SB_51529| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.015 SB_50850| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.015 SB_50473| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.015 SB_49542| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.015 SB_49495| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.015 SB_49117| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.015 SB_49064| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.015 SB_48393| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.015 SB_47872| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.015 SB_47732| Best HMM Match : Pkinase (HMM E-Value=0.0016) 37 0.015 SB_47276| Best HMM Match : DUF851 (HMM E-Value=9.6) 37 0.015 SB_46649| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.015 SB_46589| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.015 SB_46412| Best HMM Match : HEAT (HMM E-Value=8) 37 0.015 SB_46374| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.015 SB_46344| Best HMM Match : ig (HMM E-Value=0.0082) 37 0.015 SB_46308| Best HMM Match : IMS (HMM E-Value=0) 37 0.015 SB_46194| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.015 SB_45914| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.015 SB_45642| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.015 SB_45291| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.015 SB_44894| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.015 SB_44606| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.015 SB_44604| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.015 SB_44358| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.015 SB_43671| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.015 SB_43630| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.015 SB_43569| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.015 SB_43145| Best HMM Match : PEGSRP (HMM E-Value=7.2) 37 0.015 SB_42831| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.015 SB_42725| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.015 SB_42655| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.015 SB_42158| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.015 SB_41806| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.015 SB_41728| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.015 SB_41712| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.015 SB_41481| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.015 SB_40939| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.015 SB_40610| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.015 SB_40566| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.015 SB_40462| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.015 SB_39942| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.015 SB_39373| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.015 SB_39201| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.015 SB_38916| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.015 SB_37690| Best HMM Match : IgG_binding_B (HMM E-Value=4.2) 37 0.015 SB_37661| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.015 SB_37536| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.015 SB_37412| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.015 SB_37245| Best HMM Match : Disintegrin (HMM E-Value=7.9) 37 0.015 SB_36865| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.015 SB_35997| Best HMM Match : Phage_fiber (HMM E-Value=0.78) 37 0.015 SB_35689| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.015 SB_35257| Best HMM Match : Sec8_exocyst (HMM E-Value=0.59) 37 0.015 SB_34829| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.015 SB_34793| Best HMM Match : TIL (HMM E-Value=4.5) 37 0.015 SB_34683| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.015 SB_34501| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.015 SB_34403| Best HMM Match : IgG_binding_B (HMM E-Value=9.3) 37 0.015 SB_34015| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.015 SB_33403| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.015 SB_33270| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.015 SB_32674| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.015 SB_32508| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.015 SB_32411| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.015 SB_32110| Best HMM Match : PEGSRP (HMM E-Value=9.6) 37 0.015 SB_31658| Best HMM Match : Arm (HMM E-Value=0.91) 37 0.015 SB_31056| Best HMM Match : Virus_P-coat (HMM E-Value=6.4) 37 0.015 SB_30810| Best HMM Match : JmjC (HMM E-Value=0.0021) 37 0.015 SB_30786| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.015 SB_30192| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.015 SB_28922| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.015 SB_28866| Best HMM Match : PhdYeFM (HMM E-Value=8.3) 37 0.015 SB_28269| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.015 SB_27927| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.015 SB_27619| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.015 SB_27047| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.015 SB_25936| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.015 SB_24859| Best HMM Match : HAP (HMM E-Value=6.4) 37 0.015 SB_24787| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.015 SB_24544| Best HMM Match : PSCyt1 (HMM E-Value=4.3) 37 0.015 SB_24181| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.015 SB_23437| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.015 SB_22658| Best HMM Match : Protamine_3 (HMM E-Value=9.6) 37 0.015 SB_22468| Best HMM Match : CUT (HMM E-Value=6.8) 37 0.015 SB_22375| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.015 SB_22254| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.015 SB_21247| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.015 SB_20864| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.015 SB_20839| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.015 SB_20747| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.015 SB_19461| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.015 SB_18812| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.015 SB_18654| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.015 SB_18436| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.015 SB_18289| Best HMM Match : IgG_binding_B (HMM E-Value=7) 37 0.015 SB_17565| Best HMM Match : EGF (HMM E-Value=5.1e-05) 37 0.015 SB_16725| Best HMM Match : DAGAT (HMM E-Value=1e-39) 37 0.015 SB_16155| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.015 SB_15493| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.015 SB_15346| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.015 SB_15295| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.015 SB_15150| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.015 SB_15134| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.015 SB_15127| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.015 SB_14936| Best HMM Match : Pep_M12B_propep (HMM E-Value=9.7) 37 0.015 SB_14862| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.015 SB_14045| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.015 SB_13480| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.015 SB_13372| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.015 SB_13236| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.015 SB_12962| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.015 >SB_4771| Best HMM Match : DEAD (HMM E-Value=0.015) Length = 592 Score = 62.1 bits (144), Expect = 5e-10 Identities = 27/52 (51%), Positives = 39/52 (75%) Frame = +1 Query: 193 EVRVEGFSYLGAGNSTTKKDAQMNAAKDFVSYLVRAGQIPQADVPEDVKAKA 348 +V+V GF Y+G G +T KK+A+ NAAKDFV +L+ AG IP VP++V A++ Sbjct: 9 QVQVTGFDYVGFGTATNKKEAEANAAKDFVGFLIGAGFIPADSVPDEVLAES 60 >SB_28728| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 92 Score = 50.0 bits (114), Expect = 2e-06 Identities = 21/29 (72%), Positives = 22/29 (75%) Frame = +2 Query: 674 IRPIXSRITIHWAVXLQRRDWXNPGVTQL 760 IRPI SRITIHW +RRDW NPGV QL Sbjct: 18 IRPIVSRITIHWPSFYKRRDWENPGVNQL 46 >SB_36408| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 458 Score = 48.0 bits (109), Expect = 8e-06 Identities = 20/24 (83%), Positives = 20/24 (83%) Frame = +2 Query: 689 SRITIHWAVXLQRRDWXNPGVTQL 760 SRITIHW LQRRDW NPGVTQL Sbjct: 278 SRITIHWPSVLQRRDWENPGVTQL 301 >SB_29769| Best HMM Match : TNFR_c6 (HMM E-Value=3.60001e-40) Length = 768 Score = 42.7 bits (96), Expect = 3e-04 Identities = 19/30 (63%), Positives = 20/30 (66%) Frame = -1 Query: 760 KLGNARVXPVXTL*XDGPVNCNTTXYRANW 671 KLGNA V P + PVNCNTT YRANW Sbjct: 24 KLGNASVFPSHDVVKRRPVNCNTTHYRANW 53 >SB_5500| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 197 Score = 42.7 bits (96), Expect = 3e-04 Identities = 19/30 (63%), Positives = 20/30 (66%) Frame = -1 Query: 760 KLGNARVXPVXTL*XDGPVNCNTTXYRANW 671 KLGNA V P + PVNCNTT YRANW Sbjct: 38 KLGNASVFPSHDVVKRRPVNCNTTHYRANW 67 >SB_17217| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 63 Score = 41.1 bits (92), Expect = 0.001 Identities = 18/30 (60%), Positives = 20/30 (66%) Frame = -1 Query: 760 KLGNARVXPVXTL*XDGPVNCNTTXYRANW 671 KLGNA+ P + PVNCNTT YRANW Sbjct: 30 KLGNAKGFPSHDVVKRRPVNCNTTHYRANW 59 >SB_33025| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 113 Score = 39.9 bits (89), Expect = 0.002 Identities = 15/17 (88%), Positives = 16/17 (94%) Frame = +1 Query: 709 GRRFTTSXLGKPWRYPT 759 GRRFTT+ LGKPWRYPT Sbjct: 97 GRRFTTTGLGKPWRYPT 113 >SB_29084| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 116 Score = 38.7 bits (86), Expect = 0.005 Identities = 18/36 (50%), Positives = 21/36 (58%) Frame = +2 Query: 653 RXGARYPIRPIXSRITIHWAVXLQRRDWXNPGVTQL 760 R G P+ ++ AV LQRRDW NPGVTQL Sbjct: 43 RGGIGDPLESTCRHASLALAVVLQRRDWENPGVTQL 78 >SB_27779| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 154 Score = 38.7 bits (86), Expect = 0.005 Identities = 18/37 (48%), Positives = 21/37 (56%) Frame = +2 Query: 650 TRXGARYPIRPIXSRITIHWAVXLQRRDWXNPGVTQL 760 TR P+ ++ AV LQRRDW NPGVTQL Sbjct: 54 TREACGDPLESTCRHASLALAVVLQRRDWENPGVTQL 90 >SB_45900| Best HMM Match : Chordopox_A13L (HMM E-Value=7.4) Length = 152 Score = 38.7 bits (86), Expect = 0.005 Identities = 21/38 (55%), Positives = 23/38 (60%), Gaps = 4/38 (10%) Frame = +2 Query: 659 GARYPIRPIXSRITIHW----AVXLQRRDWXNPGVTQL 760 G YP P SR + + AV LQRRDW NPGVTQL Sbjct: 42 GLNYPFVPKSSRHSESYYNSLAVVLQRRDWENPGVTQL 79 >SB_43339| Best HMM Match : SAC3_GANP (HMM E-Value=1.8e-09) Length = 657 Score = 38.7 bits (86), Expect = 0.005 Identities = 17/32 (53%), Positives = 20/32 (62%) Frame = +2 Query: 665 RYPIRPIXSRITIHWAVXLQRRDWXNPGVTQL 760 +YP ++ AV LQRRDW NPGVTQL Sbjct: 20 KYPPESTCRHASLALAVVLQRRDWENPGVTQL 51 >SB_11176| Best HMM Match : PTS_EIIB (HMM E-Value=4.4) Length = 117 Score = 38.3 bits (85), Expect = 0.007 Identities = 17/30 (56%), Positives = 19/30 (63%) Frame = -1 Query: 760 KLGNARVXPVXTL*XDGPVNCNTTXYRANW 671 KL +A V P + PVNCNTT YRANW Sbjct: 32 KLAHASVFPSHDVVKRRPVNCNTTHYRANW 61 >SB_42069| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 189 Score = 37.9 bits (84), Expect = 0.009 Identities = 17/32 (53%), Positives = 20/32 (62%) Frame = +2 Query: 665 RYPIRPIXSRITIHWAVXLQRRDWXNPGVTQL 760 R P+ ++ AV LQRRDW NPGVTQL Sbjct: 94 RDPLESTCRHASLALAVVLQRRDWENPGVTQL 125 >SB_38675| Best HMM Match : HEAT (HMM E-Value=0.0016) Length = 606 Score = 37.9 bits (84), Expect = 0.009 Identities = 15/18 (83%), Positives = 16/18 (88%) Frame = -2 Query: 759 SWVTPGFXQSRRCKXTAQ 706 SWVTPGF QSRRCK TA+ Sbjct: 213 SWVTPGFSQSRRCKTTAK 230 Score = 32.7 bits (71), Expect = 0.33 Identities = 14/17 (82%), Positives = 14/17 (82%) Frame = +2 Query: 710 AVXLQRRDWXNPGVTQL 760 AV LQRRDW N GVTQL Sbjct: 516 AVVLQRRDWENTGVTQL 532 Score = 28.3 bits (60), Expect = 7.2 Identities = 11/12 (91%), Positives = 11/12 (91%) Frame = +1 Query: 673 NSPYXESYYNSL 708 NSPY ESYYNSL Sbjct: 504 NSPYSESYYNSL 515 >SB_2468| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 287 Score = 37.9 bits (84), Expect = 0.009 Identities = 17/32 (53%), Positives = 20/32 (62%) Frame = +2 Query: 665 RYPIRPIXSRITIHWAVXLQRRDWXNPGVTQL 760 R P+ ++ AV LQRRDW NPGVTQL Sbjct: 57 RDPLESTCRHASLALAVVLQRRDWENPGVTQL 88 >SB_51296| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 84 Score = 37.9 bits (84), Expect = 0.009 Identities = 15/30 (50%), Positives = 20/30 (66%) Frame = +2 Query: 671 PIRPIXSRITIHWAVXLQRRDWXNPGVTQL 760 P+ + ++ AV LQRRDW NPG+TQL Sbjct: 3 PLESTCTHASLSLAVVLQRRDWKNPGITQL 32 >SB_37693| Best HMM Match : PHD (HMM E-Value=8.7e-35) Length = 2049 Score = 37.9 bits (84), Expect = 0.009 Identities = 15/18 (83%), Positives = 16/18 (88%) Frame = -2 Query: 759 SWVTPGFXQSRRCKXTAQ 706 SWVTPGF QSRRCK TA+ Sbjct: 1883 SWVTPGFSQSRRCKTTAK 1900 >SB_35835| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 129 Score = 37.9 bits (84), Expect = 0.009 Identities = 18/37 (48%), Positives = 21/37 (56%) Frame = +2 Query: 650 TRXGARYPIRPIXSRITIHWAVXLQRRDWXNPGVTQL 760 TR P+ ++ AV LQRRDW NPGVTQL Sbjct: 20 TRSTVGDPLESTCRHASLALAVVLQRRDWENPGVTQL 56 >SB_19310| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 111 Score = 37.9 bits (84), Expect = 0.009 Identities = 17/32 (53%), Positives = 20/32 (62%) Frame = +2 Query: 665 RYPIRPIXSRITIHWAVXLQRRDWXNPGVTQL 760 R P+ ++ AV LQRRDW NPGVTQL Sbjct: 7 RDPLESTCRHASLALAVVLQRRDWENPGVTQL 38 >SB_11962| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 79 Score = 37.9 bits (84), Expect = 0.009 Identities = 17/32 (53%), Positives = 20/32 (62%) Frame = +2 Query: 665 RYPIRPIXSRITIHWAVXLQRRDWXNPGVTQL 760 R P+ ++ AV LQRRDW NPGVTQL Sbjct: 10 RDPLESTCRHASLALAVVLQRRDWENPGVTQL 41 >SB_10099| Best HMM Match : Neur_chan_LBD (HMM E-Value=3.6e-17) Length = 629 Score = 37.9 bits (84), Expect = 0.009 Identities = 15/18 (83%), Positives = 16/18 (88%) Frame = -2 Query: 759 SWVTPGFXQSRRCKXTAQ 706 SWVTPGF QSRRCK TA+ Sbjct: 493 SWVTPGFSQSRRCKTTAR 510 >SB_59802| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 3213 Score = 37.5 bits (83), Expect = 0.012 Identities = 15/17 (88%), Positives = 15/17 (88%) Frame = -2 Query: 759 SWVTPGFXQSRRCKXTA 709 SWVTPGF QSRRCK TA Sbjct: 506 SWVTPGFSQSRRCKTTA 522 >SB_59119| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 55 Score = 37.5 bits (83), Expect = 0.012 Identities = 15/17 (88%), Positives = 15/17 (88%) Frame = -2 Query: 759 SWVTPGFXQSRRCKXTA 709 SWVTPGF QSRRCK TA Sbjct: 31 SWVTPGFSQSRRCKTTA 47 >SB_58967| Best HMM Match : Sec23_BS (HMM E-Value=5.9) Length = 123 Score = 37.5 bits (83), Expect = 0.012 Identities = 15/17 (88%), Positives = 15/17 (88%) Frame = -2 Query: 759 SWVTPGFXQSRRCKXTA 709 SWVTPGF QSRRCK TA Sbjct: 53 SWVTPGFSQSRRCKTTA 69 >SB_58852| Best HMM Match : Hormone_4 (HMM E-Value=2.8) Length = 212 Score = 37.5 bits (83), Expect = 0.012 Identities = 15/17 (88%), Positives = 15/17 (88%) Frame = -2 Query: 759 SWVTPGFXQSRRCKXTA 709 SWVTPGF QSRRCK TA Sbjct: 176 SWVTPGFSQSRRCKTTA 192 >SB_58792| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 57 Score = 37.5 bits (83), Expect = 0.012 Identities = 15/17 (88%), Positives = 15/17 (88%) Frame = -2 Query: 759 SWVTPGFXQSRRCKXTA 709 SWVTPGF QSRRCK TA Sbjct: 38 SWVTPGFSQSRRCKTTA 54 >SB_58713| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 55 Score = 37.5 bits (83), Expect = 0.012 Identities = 15/17 (88%), Positives = 15/17 (88%) Frame = -2 Query: 759 SWVTPGFXQSRRCKXTA 709 SWVTPGF QSRRCK TA Sbjct: 31 SWVTPGFSQSRRCKTTA 47 >SB_58195| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 64 Score = 37.5 bits (83), Expect = 0.012 Identities = 15/17 (88%), Positives = 15/17 (88%) Frame = -2 Query: 759 SWVTPGFXQSRRCKXTA 709 SWVTPGF QSRRCK TA Sbjct: 31 SWVTPGFSQSRRCKTTA 47 >SB_58029| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 63 Score = 37.5 bits (83), Expect = 0.012 Identities = 15/17 (88%), Positives = 15/17 (88%) Frame = -2 Query: 759 SWVTPGFXQSRRCKXTA 709 SWVTPGF QSRRCK TA Sbjct: 31 SWVTPGFSQSRRCKTTA 47 >SB_56603| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 72 Score = 37.5 bits (83), Expect = 0.012 Identities = 15/17 (88%), Positives = 15/17 (88%) Frame = -2 Query: 759 SWVTPGFXQSRRCKXTA 709 SWVTPGF QSRRCK TA Sbjct: 31 SWVTPGFSQSRRCKTTA 47 >SB_56369| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 328 Score = 37.5 bits (83), Expect = 0.012 Identities = 15/17 (88%), Positives = 15/17 (88%) Frame = -2 Query: 759 SWVTPGFXQSRRCKXTA 709 SWVTPGF QSRRCK TA Sbjct: 253 SWVTPGFSQSRRCKTTA 269 >SB_55830| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 431 Score = 37.5 bits (83), Expect = 0.012 Identities = 15/17 (88%), Positives = 15/17 (88%) Frame = -2 Query: 759 SWVTPGFXQSRRCKXTA 709 SWVTPGF QSRRCK TA Sbjct: 397 SWVTPGFSQSRRCKTTA 413 >SB_55579| Best HMM Match : Rhodanese (HMM E-Value=9.2e-29) Length = 269 Score = 37.5 bits (83), Expect = 0.012 Identities = 15/17 (88%), Positives = 15/17 (88%) Frame = -2 Query: 759 SWVTPGFXQSRRCKXTA 709 SWVTPGF QSRRCK TA Sbjct: 250 SWVTPGFSQSRRCKTTA 266 >SB_54985| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 65 Score = 37.5 bits (83), Expect = 0.012 Identities = 15/17 (88%), Positives = 15/17 (88%) Frame = -2 Query: 759 SWVTPGFXQSRRCKXTA 709 SWVTPGF QSRRCK TA Sbjct: 31 SWVTPGFSQSRRCKTTA 47 >SB_54503| Best HMM Match : DUF753 (HMM E-Value=4.7) Length = 141 Score = 37.5 bits (83), Expect = 0.012 Identities = 15/17 (88%), Positives = 15/17 (88%) Frame = -2 Query: 759 SWVTPGFXQSRRCKXTA 709 SWVTPGF QSRRCK TA Sbjct: 53 SWVTPGFSQSRRCKTTA 69 >SB_53675| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 69 Score = 37.5 bits (83), Expect = 0.012 Identities = 15/17 (88%), Positives = 15/17 (88%) Frame = -2 Query: 759 SWVTPGFXQSRRCKXTA 709 SWVTPGF QSRRCK TA Sbjct: 31 SWVTPGFSQSRRCKTTA 47 >SB_53669| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 77 Score = 37.5 bits (83), Expect = 0.012 Identities = 15/17 (88%), Positives = 15/17 (88%) Frame = -2 Query: 759 SWVTPGFXQSRRCKXTA 709 SWVTPGF QSRRCK TA Sbjct: 31 SWVTPGFSQSRRCKTTA 47 >SB_53077| Best HMM Match : SRP54_N (HMM E-Value=1.8) Length = 533 Score = 37.5 bits (83), Expect = 0.012 Identities = 15/17 (88%), Positives = 15/17 (88%) Frame = -2 Query: 759 SWVTPGFXQSRRCKXTA 709 SWVTPGF QSRRCK TA Sbjct: 99 SWVTPGFSQSRRCKTTA 115 >SB_52837| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 67 Score = 37.5 bits (83), Expect = 0.012 Identities = 15/17 (88%), Positives = 15/17 (88%) Frame = -2 Query: 759 SWVTPGFXQSRRCKXTA 709 SWVTPGF QSRRCK TA Sbjct: 31 SWVTPGFSQSRRCKTTA 47 >SB_51967| Best HMM Match : Wzy_C (HMM E-Value=7.3) Length = 185 Score = 37.5 bits (83), Expect = 0.012 Identities = 15/17 (88%), Positives = 15/17 (88%) Frame = -2 Query: 759 SWVTPGFXQSRRCKXTA 709 SWVTPGF QSRRCK TA Sbjct: 53 SWVTPGFSQSRRCKTTA 69 >SB_50928| Best HMM Match : 7tm_2 (HMM E-Value=4.7e-07) Length = 1127 Score = 37.5 bits (83), Expect = 0.012 Identities = 15/17 (88%), Positives = 15/17 (88%) Frame = -2 Query: 759 SWVTPGFXQSRRCKXTA 709 SWVTPGF QSRRCK TA Sbjct: 680 SWVTPGFSQSRRCKTTA 696 >SB_50489| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 65 Score = 37.5 bits (83), Expect = 0.012 Identities = 15/17 (88%), Positives = 15/17 (88%) Frame = -2 Query: 759 SWVTPGFXQSRRCKXTA 709 SWVTPGF QSRRCK TA Sbjct: 31 SWVTPGFSQSRRCKTTA 47 >SB_50209| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 473 Score = 37.5 bits (83), Expect = 0.012 Identities = 15/17 (88%), Positives = 15/17 (88%) Frame = -2 Query: 759 SWVTPGFXQSRRCKXTA 709 SWVTPGF QSRRCK TA Sbjct: 31 SWVTPGFSQSRRCKTTA 47 >SB_50159| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 65 Score = 37.5 bits (83), Expect = 0.012 Identities = 15/17 (88%), Positives = 15/17 (88%) Frame = -2 Query: 759 SWVTPGFXQSRRCKXTA 709 SWVTPGF QSRRCK TA Sbjct: 31 SWVTPGFSQSRRCKTTA 47 >SB_50054| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 937 Score = 37.5 bits (83), Expect = 0.012 Identities = 15/17 (88%), Positives = 15/17 (88%) Frame = -2 Query: 759 SWVTPGFXQSRRCKXTA 709 SWVTPGF QSRRCK TA Sbjct: 918 SWVTPGFSQSRRCKTTA 934 >SB_49806| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 50 Score = 37.5 bits (83), Expect = 0.012 Identities = 15/17 (88%), Positives = 15/17 (88%) Frame = -2 Query: 759 SWVTPGFXQSRRCKXTA 709 SWVTPGF QSRRCK TA Sbjct: 31 SWVTPGFSQSRRCKTTA 47 >SB_48895| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 829 Score = 37.5 bits (83), Expect = 0.012 Identities = 15/17 (88%), Positives = 15/17 (88%) Frame = -2 Query: 759 SWVTPGFXQSRRCKXTA 709 SWVTPGF QSRRCK TA Sbjct: 186 SWVTPGFSQSRRCKTTA 202 >SB_48422| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 111 Score = 37.5 bits (83), Expect = 0.012 Identities = 15/17 (88%), Positives = 15/17 (88%) Frame = -2 Query: 759 SWVTPGFXQSRRCKXTA 709 SWVTPGF QSRRCK TA Sbjct: 53 SWVTPGFSQSRRCKTTA 69 >SB_47991| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 65 Score = 37.5 bits (83), Expect = 0.012 Identities = 15/17 (88%), Positives = 15/17 (88%) Frame = -2 Query: 759 SWVTPGFXQSRRCKXTA 709 SWVTPGF QSRRCK TA Sbjct: 31 SWVTPGFSQSRRCKTTA 47 >SB_47859| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 63 Score = 37.5 bits (83), Expect = 0.012 Identities = 15/17 (88%), Positives = 15/17 (88%) Frame = -2 Query: 759 SWVTPGFXQSRRCKXTA 709 SWVTPGF QSRRCK TA Sbjct: 31 SWVTPGFSQSRRCKTTA 47 >SB_47433| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 49 Score = 37.5 bits (83), Expect = 0.012 Identities = 15/17 (88%), Positives = 15/17 (88%) Frame = -2 Query: 759 SWVTPGFXQSRRCKXTA 709 SWVTPGF QSRRCK TA Sbjct: 30 SWVTPGFSQSRRCKTTA 46 >SB_47291| Best HMM Match : PilN (HMM E-Value=0.75) Length = 424 Score = 37.5 bits (83), Expect = 0.012 Identities = 15/17 (88%), Positives = 15/17 (88%) Frame = -2 Query: 759 SWVTPGFXQSRRCKXTA 709 SWVTPGF QSRRCK TA Sbjct: 405 SWVTPGFSQSRRCKTTA 421 >SB_46080| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 68 Score = 37.5 bits (83), Expect = 0.012 Identities = 15/17 (88%), Positives = 15/17 (88%) Frame = -2 Query: 759 SWVTPGFXQSRRCKXTA 709 SWVTPGF QSRRCK TA Sbjct: 31 SWVTPGFSQSRRCKTTA 47 >SB_45570| Best HMM Match : Euplotes_phero (HMM E-Value=2.6) Length = 388 Score = 37.5 bits (83), Expect = 0.012 Identities = 15/17 (88%), Positives = 15/17 (88%) Frame = -2 Query: 759 SWVTPGFXQSRRCKXTA 709 SWVTPGF QSRRCK TA Sbjct: 31 SWVTPGFSQSRRCKTTA 47 >SB_45449| Best HMM Match : Glyco_hydro_47 (HMM E-Value=1.4e-07) Length = 305 Score = 37.5 bits (83), Expect = 0.012 Identities = 15/17 (88%), Positives = 15/17 (88%) Frame = -2 Query: 759 SWVTPGFXQSRRCKXTA 709 SWVTPGF QSRRCK TA Sbjct: 31 SWVTPGFSQSRRCKTTA 47 >SB_45437| Best HMM Match : Ribosomal_L15e (HMM E-Value=0.53) Length = 273 Score = 37.5 bits (83), Expect = 0.012 Identities = 15/17 (88%), Positives = 15/17 (88%) Frame = -2 Query: 759 SWVTPGFXQSRRCKXTA 709 SWVTPGF QSRRCK TA Sbjct: 254 SWVTPGFSQSRRCKTTA 270 >SB_43819| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 62 Score = 37.5 bits (83), Expect = 0.012 Identities = 15/17 (88%), Positives = 15/17 (88%) Frame = -2 Query: 759 SWVTPGFXQSRRCKXTA 709 SWVTPGF QSRRCK TA Sbjct: 31 SWVTPGFSQSRRCKTTA 47 >SB_42949| Best HMM Match : SRCR (HMM E-Value=1.6e-14) Length = 340 Score = 37.5 bits (83), Expect = 0.012 Identities = 15/17 (88%), Positives = 15/17 (88%) Frame = -2 Query: 759 SWVTPGFXQSRRCKXTA 709 SWVTPGF QSRRCK TA Sbjct: 321 SWVTPGFSQSRRCKTTA 337 >SB_42593| Best HMM Match : Rho_GDI (HMM E-Value=3.7e-17) Length = 339 Score = 37.5 bits (83), Expect = 0.012 Identities = 15/17 (88%), Positives = 15/17 (88%) Frame = -2 Query: 759 SWVTPGFXQSRRCKXTA 709 SWVTPGF QSRRCK TA Sbjct: 238 SWVTPGFSQSRRCKTTA 254 >SB_42373| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 68 Score = 37.5 bits (83), Expect = 0.012 Identities = 15/17 (88%), Positives = 15/17 (88%) Frame = -2 Query: 759 SWVTPGFXQSRRCKXTA 709 SWVTPGF QSRRCK TA Sbjct: 31 SWVTPGFSQSRRCKTTA 47 >SB_42112| Best HMM Match : Herpes_UL49_2 (HMM E-Value=1.5) Length = 154 Score = 37.5 bits (83), Expect = 0.012 Identities = 15/17 (88%), Positives = 15/17 (88%) Frame = -2 Query: 759 SWVTPGFXQSRRCKXTA 709 SWVTPGF QSRRCK TA Sbjct: 31 SWVTPGFSQSRRCKTTA 47 >SB_41202| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 65 Score = 37.5 bits (83), Expect = 0.012 Identities = 15/17 (88%), Positives = 15/17 (88%) Frame = -2 Query: 759 SWVTPGFXQSRRCKXTA 709 SWVTPGF QSRRCK TA Sbjct: 31 SWVTPGFSQSRRCKTTA 47 >SB_41136| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 115 Score = 37.5 bits (83), Expect = 0.012 Identities = 15/17 (88%), Positives = 15/17 (88%) Frame = -2 Query: 759 SWVTPGFXQSRRCKXTA 709 SWVTPGF QSRRCK TA Sbjct: 31 SWVTPGFSQSRRCKTTA 47 >SB_41068| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 141 Score = 37.5 bits (83), Expect = 0.012 Identities = 15/17 (88%), Positives = 15/17 (88%) Frame = -2 Query: 759 SWVTPGFXQSRRCKXTA 709 SWVTPGF QSRRCK TA Sbjct: 53 SWVTPGFSQSRRCKTTA 69 >SB_40980| Best HMM Match : ANF_receptor (HMM E-Value=0.00014) Length = 735 Score = 37.5 bits (83), Expect = 0.012 Identities = 15/17 (88%), Positives = 15/17 (88%) Frame = -2 Query: 759 SWVTPGFXQSRRCKXTA 709 SWVTPGF QSRRCK TA Sbjct: 589 SWVTPGFSQSRRCKTTA 605 >SB_40764| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 62 Score = 37.5 bits (83), Expect = 0.012 Identities = 15/17 (88%), Positives = 15/17 (88%) Frame = -2 Query: 759 SWVTPGFXQSRRCKXTA 709 SWVTPGF QSRRCK TA Sbjct: 31 SWVTPGFSQSRRCKTTA 47 >SB_40601| Best HMM Match : VWA_CoxE (HMM E-Value=6.3) Length = 666 Score = 37.5 bits (83), Expect = 0.012 Identities = 15/17 (88%), Positives = 15/17 (88%) Frame = -2 Query: 759 SWVTPGFXQSRRCKXTA 709 SWVTPGF QSRRCK TA Sbjct: 436 SWVTPGFSQSRRCKTTA 452 >SB_40576| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 71 Score = 37.5 bits (83), Expect = 0.012 Identities = 15/17 (88%), Positives = 15/17 (88%) Frame = -2 Query: 759 SWVTPGFXQSRRCKXTA 709 SWVTPGF QSRRCK TA Sbjct: 31 SWVTPGFSQSRRCKTTA 47 >SB_40463| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 71 Score = 37.5 bits (83), Expect = 0.012 Identities = 15/17 (88%), Positives = 15/17 (88%) Frame = -2 Query: 759 SWVTPGFXQSRRCKXTA 709 SWVTPGF QSRRCK TA Sbjct: 31 SWVTPGFSQSRRCKTTA 47 >SB_40182| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 151 Score = 37.5 bits (83), Expect = 0.012 Identities = 15/17 (88%), Positives = 15/17 (88%) Frame = -2 Query: 759 SWVTPGFXQSRRCKXTA 709 SWVTPGF QSRRCK TA Sbjct: 31 SWVTPGFSQSRRCKTTA 47 >SB_40068| Best HMM Match : Pkinase_Tyr (HMM E-Value=0) Length = 406 Score = 37.5 bits (83), Expect = 0.012 Identities = 15/17 (88%), Positives = 15/17 (88%) Frame = -2 Query: 759 SWVTPGFXQSRRCKXTA 709 SWVTPGF QSRRCK TA Sbjct: 387 SWVTPGFSQSRRCKTTA 403 >SB_40003| Best HMM Match : YTV (HMM E-Value=8.9) Length = 128 Score = 37.5 bits (83), Expect = 0.012 Identities = 15/17 (88%), Positives = 15/17 (88%) Frame = -2 Query: 759 SWVTPGFXQSRRCKXTA 709 SWVTPGF QSRRCK TA Sbjct: 31 SWVTPGFSQSRRCKTTA 47 >SB_39444| Best HMM Match : SAC3_GANP (HMM E-Value=0.68) Length = 794 Score = 37.5 bits (83), Expect = 0.012 Identities = 15/17 (88%), Positives = 15/17 (88%) Frame = -2 Query: 759 SWVTPGFXQSRRCKXTA 709 SWVTPGF QSRRCK TA Sbjct: 31 SWVTPGFSQSRRCKTTA 47 >SB_38813| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 66 Score = 37.5 bits (83), Expect = 0.012 Identities = 15/17 (88%), Positives = 15/17 (88%) Frame = -2 Query: 759 SWVTPGFXQSRRCKXTA 709 SWVTPGF QSRRCK TA Sbjct: 31 SWVTPGFSQSRRCKTTA 47 >SB_38774| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 104 Score = 37.5 bits (83), Expect = 0.012 Identities = 15/17 (88%), Positives = 15/17 (88%) Frame = -2 Query: 759 SWVTPGFXQSRRCKXTA 709 SWVTPGF QSRRCK TA Sbjct: 53 SWVTPGFSQSRRCKTTA 69 >SB_38425| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 114 Score = 37.5 bits (83), Expect = 0.012 Identities = 15/17 (88%), Positives = 15/17 (88%) Frame = -2 Query: 759 SWVTPGFXQSRRCKXTA 709 SWVTPGF QSRRCK TA Sbjct: 53 SWVTPGFSQSRRCKTTA 69 >SB_38203| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 80 Score = 37.5 bits (83), Expect = 0.012 Identities = 15/17 (88%), Positives = 15/17 (88%) Frame = -2 Query: 759 SWVTPGFXQSRRCKXTA 709 SWVTPGF QSRRCK TA Sbjct: 31 SWVTPGFSQSRRCKTTA 47 >SB_38016| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 215 Score = 37.5 bits (83), Expect = 0.012 Identities = 18/37 (48%), Positives = 21/37 (56%) Frame = +2 Query: 650 TRXGARYPIRPIXSRITIHWAVXLQRRDWXNPGVTQL 760 TR P+ ++ AV LQRRDW NPGVTQL Sbjct: 115 TRFVVGDPLESTCRHASLALAVVLQRRDWENPGVTQL 151 >SB_37771| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 101 Score = 37.5 bits (83), Expect = 0.012 Identities = 15/17 (88%), Positives = 15/17 (88%) Frame = -2 Query: 759 SWVTPGFXQSRRCKXTA 709 SWVTPGF QSRRCK TA Sbjct: 63 SWVTPGFSQSRRCKTTA 79 >SB_36681| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1081 Score = 37.5 bits (83), Expect = 0.012 Identities = 15/17 (88%), Positives = 15/17 (88%) Frame = -2 Query: 759 SWVTPGFXQSRRCKXTA 709 SWVTPGF QSRRCK TA Sbjct: 819 SWVTPGFSQSRRCKTTA 835 >SB_36207| Best HMM Match : 7kD_coat (HMM E-Value=7.6) Length = 98 Score = 37.5 bits (83), Expect = 0.012 Identities = 15/17 (88%), Positives = 15/17 (88%) Frame = -2 Query: 759 SWVTPGFXQSRRCKXTA 709 SWVTPGF QSRRCK TA Sbjct: 79 SWVTPGFSQSRRCKTTA 95 >SB_36014| Best HMM Match : DUF437 (HMM E-Value=6.4) Length = 240 Score = 37.5 bits (83), Expect = 0.012 Identities = 15/17 (88%), Positives = 15/17 (88%) Frame = -2 Query: 759 SWVTPGFXQSRRCKXTA 709 SWVTPGF QSRRCK TA Sbjct: 53 SWVTPGFSQSRRCKTTA 69 >SB_35849| Best HMM Match : Fibrinogen_C (HMM E-Value=0.15) Length = 631 Score = 37.5 bits (83), Expect = 0.012 Identities = 15/17 (88%), Positives = 15/17 (88%) Frame = -2 Query: 759 SWVTPGFXQSRRCKXTA 709 SWVTPGF QSRRCK TA Sbjct: 480 SWVTPGFSQSRRCKTTA 496 >SB_35317| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 77 Score = 37.5 bits (83), Expect = 0.012 Identities = 15/17 (88%), Positives = 15/17 (88%) Frame = -2 Query: 759 SWVTPGFXQSRRCKXTA 709 SWVTPGF QSRRCK TA Sbjct: 31 SWVTPGFSQSRRCKTTA 47 >SB_35151| Best HMM Match : DUF589 (HMM E-Value=7.5) Length = 297 Score = 37.5 bits (83), Expect = 0.012 Identities = 15/17 (88%), Positives = 15/17 (88%) Frame = -2 Query: 759 SWVTPGFXQSRRCKXTA 709 SWVTPGF QSRRCK TA Sbjct: 53 SWVTPGFSQSRRCKTTA 69 >SB_34685| Best HMM Match : RNA_pol_A_bac (HMM E-Value=1.8) Length = 143 Score = 37.5 bits (83), Expect = 0.012 Identities = 15/17 (88%), Positives = 15/17 (88%) Frame = -2 Query: 759 SWVTPGFXQSRRCKXTA 709 SWVTPGF QSRRCK TA Sbjct: 53 SWVTPGFSQSRRCKTTA 69 >SB_34478| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 133 Score = 37.5 bits (83), Expect = 0.012 Identities = 15/17 (88%), Positives = 15/17 (88%) Frame = -2 Query: 759 SWVTPGFXQSRRCKXTA 709 SWVTPGF QSRRCK TA Sbjct: 99 SWVTPGFSQSRRCKTTA 115 >SB_31889| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 128 Score = 37.5 bits (83), Expect = 0.012 Identities = 15/17 (88%), Positives = 15/17 (88%) Frame = -2 Query: 759 SWVTPGFXQSRRCKXTA 709 SWVTPGF QSRRCK TA Sbjct: 53 SWVTPGFSQSRRCKTTA 69 >SB_31511| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 372 Score = 37.5 bits (83), Expect = 0.012 Identities = 15/17 (88%), Positives = 15/17 (88%) Frame = -2 Query: 759 SWVTPGFXQSRRCKXTA 709 SWVTPGF QSRRCK TA Sbjct: 38 SWVTPGFSQSRRCKTTA 54 >SB_30142| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 91 Score = 37.5 bits (83), Expect = 0.012 Identities = 15/17 (88%), Positives = 15/17 (88%) Frame = -2 Query: 759 SWVTPGFXQSRRCKXTA 709 SWVTPGF QSRRCK TA Sbjct: 45 SWVTPGFSQSRRCKTTA 61 >SB_29521| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 166 Score = 37.5 bits (83), Expect = 0.012 Identities = 15/17 (88%), Positives = 15/17 (88%) Frame = -2 Query: 759 SWVTPGFXQSRRCKXTA 709 SWVTPGF QSRRCK TA Sbjct: 38 SWVTPGFSQSRRCKTTA 54 Score = 35.9 bits (79), Expect = 0.036 Identities = 15/17 (88%), Positives = 15/17 (88%) Frame = +2 Query: 710 AVXLQRRDWXNPGVTQL 760 AV LQRRDW NPGVTQL Sbjct: 86 AVVLQRRDWENPGVTQL 102 Score = 28.3 bits (60), Expect = 7.2 Identities = 11/12 (91%), Positives = 11/12 (91%) Frame = +1 Query: 673 NSPYXESYYNSL 708 NSPY ESYYNSL Sbjct: 74 NSPYSESYYNSL 85 >SB_29043| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 68 Score = 37.5 bits (83), Expect = 0.012 Identities = 15/17 (88%), Positives = 15/17 (88%) Frame = -2 Query: 759 SWVTPGFXQSRRCKXTA 709 SWVTPGF QSRRCK TA Sbjct: 31 SWVTPGFSQSRRCKTTA 47 >SB_28650| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 80 Score = 37.5 bits (83), Expect = 0.012 Identities = 15/17 (88%), Positives = 15/17 (88%) Frame = -2 Query: 759 SWVTPGFXQSRRCKXTA 709 SWVTPGF QSRRCK TA Sbjct: 31 SWVTPGFSQSRRCKTTA 47 >SB_28487| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 71 Score = 37.5 bits (83), Expect = 0.012 Identities = 15/17 (88%), Positives = 15/17 (88%) Frame = -2 Query: 759 SWVTPGFXQSRRCKXTA 709 SWVTPGF QSRRCK TA Sbjct: 31 SWVTPGFSQSRRCKTTA 47 >SB_28424| Best HMM Match : SAM_1 (HMM E-Value=8e-06) Length = 214 Score = 37.5 bits (83), Expect = 0.012 Identities = 15/17 (88%), Positives = 15/17 (88%) Frame = -2 Query: 759 SWVTPGFXQSRRCKXTA 709 SWVTPGF QSRRCK TA Sbjct: 31 SWVTPGFSQSRRCKTTA 47 >SB_28245| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 62 Score = 37.5 bits (83), Expect = 0.012 Identities = 15/17 (88%), Positives = 15/17 (88%) Frame = -2 Query: 759 SWVTPGFXQSRRCKXTA 709 SWVTPGF QSRRCK TA Sbjct: 31 SWVTPGFSQSRRCKTTA 47 >SB_27897| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 50 Score = 37.5 bits (83), Expect = 0.012 Identities = 15/17 (88%), Positives = 15/17 (88%) Frame = -2 Query: 759 SWVTPGFXQSRRCKXTA 709 SWVTPGF QSRRCK TA Sbjct: 31 SWVTPGFSQSRRCKTTA 47 >SB_27137| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 119 Score = 37.5 bits (83), Expect = 0.012 Identities = 15/17 (88%), Positives = 15/17 (88%) Frame = -2 Query: 759 SWVTPGFXQSRRCKXTA 709 SWVTPGF QSRRCK TA Sbjct: 31 SWVTPGFSQSRRCKTTA 47 >SB_27095| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 534 Score = 37.5 bits (83), Expect = 0.012 Identities = 15/17 (88%), Positives = 15/17 (88%) Frame = -2 Query: 759 SWVTPGFXQSRRCKXTA 709 SWVTPGF QSRRCK TA Sbjct: 401 SWVTPGFSQSRRCKTTA 417 >SB_27010| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 50 Score = 37.5 bits (83), Expect = 0.012 Identities = 15/17 (88%), Positives = 15/17 (88%) Frame = -2 Query: 759 SWVTPGFXQSRRCKXTA 709 SWVTPGF QSRRCK TA Sbjct: 31 SWVTPGFSQSRRCKTTA 47 >SB_26995| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 57 Score = 37.5 bits (83), Expect = 0.012 Identities = 15/17 (88%), Positives = 15/17 (88%) Frame = -2 Query: 759 SWVTPGFXQSRRCKXTA 709 SWVTPGF QSRRCK TA Sbjct: 38 SWVTPGFSQSRRCKTTA 54 >SB_26954| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 113 Score = 37.5 bits (83), Expect = 0.012 Identities = 15/17 (88%), Positives = 15/17 (88%) Frame = -2 Query: 759 SWVTPGFXQSRRCKXTA 709 SWVTPGF QSRRCK TA Sbjct: 31 SWVTPGFSQSRRCKTTA 47 >SB_26672| Best HMM Match : Exo_endo_phos (HMM E-Value=0.46) Length = 1232 Score = 37.5 bits (83), Expect = 0.012 Identities = 15/17 (88%), Positives = 15/17 (88%) Frame = -2 Query: 759 SWVTPGFXQSRRCKXTA 709 SWVTPGF QSRRCK TA Sbjct: 1135 SWVTPGFSQSRRCKTTA 1151 >SB_26607| Best HMM Match : K_tetra (HMM E-Value=3.3e-08) Length = 412 Score = 37.5 bits (83), Expect = 0.012 Identities = 15/17 (88%), Positives = 15/17 (88%) Frame = -2 Query: 759 SWVTPGFXQSRRCKXTA 709 SWVTPGF QSRRCK TA Sbjct: 326 SWVTPGFSQSRRCKTTA 342 >SB_25727| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1758 Score = 37.5 bits (83), Expect = 0.012 Identities = 15/17 (88%), Positives = 15/17 (88%) Frame = -2 Query: 759 SWVTPGFXQSRRCKXTA 709 SWVTPGF QSRRCK TA Sbjct: 140 SWVTPGFSQSRRCKTTA 156 >SB_25469| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 87 Score = 37.5 bits (83), Expect = 0.012 Identities = 15/17 (88%), Positives = 15/17 (88%) Frame = -2 Query: 759 SWVTPGFXQSRRCKXTA 709 SWVTPGF QSRRCK TA Sbjct: 50 SWVTPGFSQSRRCKTTA 66 >SB_25193| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 70 Score = 37.5 bits (83), Expect = 0.012 Identities = 15/17 (88%), Positives = 15/17 (88%) Frame = -2 Query: 759 SWVTPGFXQSRRCKXTA 709 SWVTPGF QSRRCK TA Sbjct: 31 SWVTPGFSQSRRCKTTA 47 >SB_24322| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 46 Score = 37.5 bits (83), Expect = 0.012 Identities = 15/17 (88%), Positives = 15/17 (88%) Frame = -2 Query: 759 SWVTPGFXQSRRCKXTA 709 SWVTPGF QSRRCK TA Sbjct: 12 SWVTPGFSQSRRCKTTA 28 >SB_23294| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 65 Score = 37.5 bits (83), Expect = 0.012 Identities = 15/17 (88%), Positives = 15/17 (88%) Frame = -2 Query: 759 SWVTPGFXQSRRCKXTA 709 SWVTPGF QSRRCK TA Sbjct: 31 SWVTPGFSQSRRCKTTA 47 >SB_23196| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 67 Score = 37.5 bits (83), Expect = 0.012 Identities = 15/17 (88%), Positives = 15/17 (88%) Frame = -2 Query: 759 SWVTPGFXQSRRCKXTA 709 SWVTPGF QSRRCK TA Sbjct: 24 SWVTPGFSQSRRCKTTA 40 >SB_23195| Best HMM Match : zf-C3HC4 (HMM E-Value=1.3e-10) Length = 466 Score = 37.5 bits (83), Expect = 0.012 Identities = 15/17 (88%), Positives = 15/17 (88%) Frame = -2 Query: 759 SWVTPGFXQSRRCKXTA 709 SWVTPGF QSRRCK TA Sbjct: 31 SWVTPGFSQSRRCKTTA 47 >SB_22108| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 83 Score = 37.5 bits (83), Expect = 0.012 Identities = 15/17 (88%), Positives = 15/17 (88%) Frame = -2 Query: 759 SWVTPGFXQSRRCKXTA 709 SWVTPGF QSRRCK TA Sbjct: 31 SWVTPGFSQSRRCKTTA 47 >SB_21853| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 79 Score = 37.5 bits (83), Expect = 0.012 Identities = 15/17 (88%), Positives = 15/17 (88%) Frame = -2 Query: 759 SWVTPGFXQSRRCKXTA 709 SWVTPGF QSRRCK TA Sbjct: 31 SWVTPGFSQSRRCKTTA 47 >SB_21523| Best HMM Match : Pkinase (HMM E-Value=9.5e-14) Length = 322 Score = 37.5 bits (83), Expect = 0.012 Identities = 15/17 (88%), Positives = 15/17 (88%) Frame = -2 Query: 759 SWVTPGFXQSRRCKXTA 709 SWVTPGF QSRRCK TA Sbjct: 53 SWVTPGFSQSRRCKTTA 69 >SB_20900| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 57 Score = 37.5 bits (83), Expect = 0.012 Identities = 15/17 (88%), Positives = 15/17 (88%) Frame = -2 Query: 759 SWVTPGFXQSRRCKXTA 709 SWVTPGF QSRRCK TA Sbjct: 38 SWVTPGFSQSRRCKTTA 54 >SB_20847| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 117 Score = 37.5 bits (83), Expect = 0.012 Identities = 15/17 (88%), Positives = 15/17 (88%) Frame = -2 Query: 759 SWVTPGFXQSRRCKXTA 709 SWVTPGF QSRRCK TA Sbjct: 53 SWVTPGFSQSRRCKTTA 69 >SB_20814| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 80 Score = 37.5 bits (83), Expect = 0.012 Identities = 15/17 (88%), Positives = 15/17 (88%) Frame = -2 Query: 759 SWVTPGFXQSRRCKXTA 709 SWVTPGF QSRRCK TA Sbjct: 61 SWVTPGFSQSRRCKTTA 77 >SB_20629| Best HMM Match : WD40 (HMM E-Value=0.0014) Length = 230 Score = 37.5 bits (83), Expect = 0.012 Identities = 15/17 (88%), Positives = 15/17 (88%) Frame = -2 Query: 759 SWVTPGFXQSRRCKXTA 709 SWVTPGF QSRRCK TA Sbjct: 66 SWVTPGFSQSRRCKTTA 82 >SB_18983| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 78 Score = 37.5 bits (83), Expect = 0.012 Identities = 15/17 (88%), Positives = 15/17 (88%) Frame = -2 Query: 759 SWVTPGFXQSRRCKXTA 709 SWVTPGF QSRRCK TA Sbjct: 31 SWVTPGFSQSRRCKTTA 47 >SB_18796| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 80 Score = 37.5 bits (83), Expect = 0.012 Identities = 15/17 (88%), Positives = 15/17 (88%) Frame = -2 Query: 759 SWVTPGFXQSRRCKXTA 709 SWVTPGF QSRRCK TA Sbjct: 31 SWVTPGFSQSRRCKTTA 47 >SB_18538| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 189 Score = 37.5 bits (83), Expect = 0.012 Identities = 15/17 (88%), Positives = 15/17 (88%) Frame = -2 Query: 759 SWVTPGFXQSRRCKXTA 709 SWVTPGF QSRRCK TA Sbjct: 53 SWVTPGFSQSRRCKTTA 69 >SB_18411| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 37.5 bits (83), Expect = 0.012 Identities = 15/17 (88%), Positives = 15/17 (88%) Frame = -2 Query: 759 SWVTPGFXQSRRCKXTA 709 SWVTPGF QSRRCK TA Sbjct: 53 SWVTPGFSQSRRCKTTA 69 >SB_18318| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 119 Score = 37.5 bits (83), Expect = 0.012 Identities = 15/17 (88%), Positives = 15/17 (88%) Frame = -2 Query: 759 SWVTPGFXQSRRCKXTA 709 SWVTPGF QSRRCK TA Sbjct: 31 SWVTPGFSQSRRCKTTA 47 >SB_18158| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 110 Score = 37.5 bits (83), Expect = 0.012 Identities = 15/17 (88%), Positives = 15/17 (88%) Frame = -2 Query: 759 SWVTPGFXQSRRCKXTA 709 SWVTPGF QSRRCK TA Sbjct: 53 SWVTPGFSQSRRCKTTA 69 >SB_17237| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 78 Score = 37.5 bits (83), Expect = 0.012 Identities = 15/17 (88%), Positives = 15/17 (88%) Frame = -2 Query: 759 SWVTPGFXQSRRCKXTA 709 SWVTPGF QSRRCK TA Sbjct: 45 SWVTPGFSQSRRCKTTA 61 >SB_15873| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 185 Score = 37.5 bits (83), Expect = 0.012 Identities = 17/34 (50%), Positives = 20/34 (58%) Frame = +2 Query: 659 GARYPIRPIXSRITIHWAVXLQRRDWXNPGVTQL 760 G P+ ++ AV LQRRDW NPGVTQL Sbjct: 88 GVGDPLESTCRHASLALAVVLQRRDWENPGVTQL 121 >SB_15818| Best HMM Match : Apo-VLDL-II (HMM E-Value=1.2) Length = 218 Score = 37.5 bits (83), Expect = 0.012 Identities = 15/17 (88%), Positives = 15/17 (88%) Frame = -2 Query: 759 SWVTPGFXQSRRCKXTA 709 SWVTPGF QSRRCK TA Sbjct: 53 SWVTPGFSQSRRCKTTA 69 >SB_15447| Best HMM Match : C1_1 (HMM E-Value=0.11) Length = 316 Score = 37.5 bits (83), Expect = 0.012 Identities = 15/17 (88%), Positives = 15/17 (88%) Frame = -2 Query: 759 SWVTPGFXQSRRCKXTA 709 SWVTPGF QSRRCK TA Sbjct: 297 SWVTPGFSQSRRCKTTA 313 >SB_15375| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 62 Score = 37.5 bits (83), Expect = 0.012 Identities = 15/17 (88%), Positives = 15/17 (88%) Frame = -2 Query: 759 SWVTPGFXQSRRCKXTA 709 SWVTPGF QSRRCK TA Sbjct: 31 SWVTPGFSQSRRCKTTA 47 >SB_14672| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 66 Score = 37.5 bits (83), Expect = 0.012 Identities = 15/17 (88%), Positives = 15/17 (88%) Frame = -2 Query: 759 SWVTPGFXQSRRCKXTA 709 SWVTPGF QSRRCK TA Sbjct: 31 SWVTPGFSQSRRCKTTA 47 >SB_14518| Best HMM Match : MIB_HERC2 (HMM E-Value=2.4e-38) Length = 742 Score = 37.5 bits (83), Expect = 0.012 Identities = 15/17 (88%), Positives = 15/17 (88%) Frame = -2 Query: 759 SWVTPGFXQSRRCKXTA 709 SWVTPGF QSRRCK TA Sbjct: 516 SWVTPGFSQSRRCKTTA 532 >SB_14175| Best HMM Match : GBP_repeat (HMM E-Value=3.8) Length = 300 Score = 37.5 bits (83), Expect = 0.012 Identities = 15/17 (88%), Positives = 15/17 (88%) Frame = -2 Query: 759 SWVTPGFXQSRRCKXTA 709 SWVTPGF QSRRCK TA Sbjct: 281 SWVTPGFSQSRRCKTTA 297 >SB_14044| Best HMM Match : EGF_CA (HMM E-Value=4.1e-13) Length = 184 Score = 37.5 bits (83), Expect = 0.012 Identities = 15/17 (88%), Positives = 15/17 (88%) Frame = -2 Query: 759 SWVTPGFXQSRRCKXTA 709 SWVTPGF QSRRCK TA Sbjct: 31 SWVTPGFSQSRRCKTTA 47 >SB_13919| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 83 Score = 37.5 bits (83), Expect = 0.012 Identities = 15/17 (88%), Positives = 15/17 (88%) Frame = -2 Query: 759 SWVTPGFXQSRRCKXTA 709 SWVTPGF QSRRCK TA Sbjct: 31 SWVTPGFSQSRRCKTTA 47 >SB_13475| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 63 Score = 37.5 bits (83), Expect = 0.012 Identities = 15/17 (88%), Positives = 15/17 (88%) Frame = -2 Query: 759 SWVTPGFXQSRRCKXTA 709 SWVTPGF QSRRCK TA Sbjct: 31 SWVTPGFSQSRRCKTTA 47 >SB_13295| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 66 Score = 37.5 bits (83), Expect = 0.012 Identities = 15/17 (88%), Positives = 15/17 (88%) Frame = -2 Query: 759 SWVTPGFXQSRRCKXTA 709 SWVTPGF QSRRCK TA Sbjct: 31 SWVTPGFSQSRRCKTTA 47 >SB_13049| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 64 Score = 37.5 bits (83), Expect = 0.012 Identities = 15/17 (88%), Positives = 15/17 (88%) Frame = -2 Query: 759 SWVTPGFXQSRRCKXTA 709 SWVTPGF QSRRCK TA Sbjct: 31 SWVTPGFSQSRRCKTTA 47 >SB_12559| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 141 Score = 37.5 bits (83), Expect = 0.012 Identities = 15/17 (88%), Positives = 15/17 (88%) Frame = -2 Query: 759 SWVTPGFXQSRRCKXTA 709 SWVTPGF QSRRCK TA Sbjct: 31 SWVTPGFSQSRRCKTTA 47 >SB_12016| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 81 Score = 37.5 bits (83), Expect = 0.012 Identities = 15/17 (88%), Positives = 15/17 (88%) Frame = -2 Query: 759 SWVTPGFXQSRRCKXTA 709 SWVTPGF QSRRCK TA Sbjct: 31 SWVTPGFSQSRRCKTTA 47 >SB_11991| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 155 Score = 37.5 bits (83), Expect = 0.012 Identities = 15/17 (88%), Positives = 15/17 (88%) Frame = -2 Query: 759 SWVTPGFXQSRRCKXTA 709 SWVTPGF QSRRCK TA Sbjct: 124 SWVTPGFSQSRRCKTTA 140 >SB_11294| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 125 Score = 37.5 bits (83), Expect = 0.012 Identities = 15/17 (88%), Positives = 15/17 (88%) Frame = -2 Query: 759 SWVTPGFXQSRRCKXTA 709 SWVTPGF QSRRCK TA Sbjct: 84 SWVTPGFSQSRRCKTTA 100 >SB_10976| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 84 Score = 37.5 bits (83), Expect = 0.012 Identities = 15/17 (88%), Positives = 15/17 (88%) Frame = -2 Query: 759 SWVTPGFXQSRRCKXTA 709 SWVTPGF QSRRCK TA Sbjct: 31 SWVTPGFSQSRRCKTTA 47 >SB_10247| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 76 Score = 37.5 bits (83), Expect = 0.012 Identities = 15/17 (88%), Positives = 15/17 (88%) Frame = -2 Query: 759 SWVTPGFXQSRRCKXTA 709 SWVTPGF QSRRCK TA Sbjct: 31 SWVTPGFSQSRRCKTTA 47 >SB_9391| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 67 Score = 37.5 bits (83), Expect = 0.012 Identities = 15/17 (88%), Positives = 15/17 (88%) Frame = -2 Query: 759 SWVTPGFXQSRRCKXTA 709 SWVTPGF QSRRCK TA Sbjct: 31 SWVTPGFSQSRRCKTTA 47 >SB_9055| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 70 Score = 37.5 bits (83), Expect = 0.012 Identities = 15/17 (88%), Positives = 15/17 (88%) Frame = -2 Query: 759 SWVTPGFXQSRRCKXTA 709 SWVTPGF QSRRCK TA Sbjct: 31 SWVTPGFSQSRRCKTTA 47 >SB_8565| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 76 Score = 37.5 bits (83), Expect = 0.012 Identities = 15/17 (88%), Positives = 15/17 (88%) Frame = -2 Query: 759 SWVTPGFXQSRRCKXTA 709 SWVTPGF QSRRCK TA Sbjct: 31 SWVTPGFSQSRRCKTTA 47 >SB_8424| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 50 Score = 37.5 bits (83), Expect = 0.012 Identities = 15/17 (88%), Positives = 15/17 (88%) Frame = -2 Query: 759 SWVTPGFXQSRRCKXTA 709 SWVTPGF QSRRCK TA Sbjct: 31 SWVTPGFSQSRRCKTTA 47 >SB_8222| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 127 Score = 37.5 bits (83), Expect = 0.012 Identities = 15/17 (88%), Positives = 15/17 (88%) Frame = -2 Query: 759 SWVTPGFXQSRRCKXTA 709 SWVTPGF QSRRCK TA Sbjct: 86 SWVTPGFSQSRRCKTTA 102 >SB_8126| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 65 Score = 37.5 bits (83), Expect = 0.012 Identities = 15/17 (88%), Positives = 15/17 (88%) Frame = -2 Query: 759 SWVTPGFXQSRRCKXTA 709 SWVTPGF QSRRCK TA Sbjct: 31 SWVTPGFSQSRRCKTTA 47 >SB_7849| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 191 Score = 37.5 bits (83), Expect = 0.012 Identities = 18/24 (75%), Positives = 18/24 (75%) Frame = +2 Query: 689 SRITIHWAVXLQRRDWXNPGVTQL 760 SRIT AV LQRRDW N GVTQL Sbjct: 89 SRITNSLAVVLQRRDWENTGVTQL 112 >SB_7261| Best HMM Match : RHS (HMM E-Value=5.3) Length = 137 Score = 37.5 bits (83), Expect = 0.012 Identities = 15/17 (88%), Positives = 15/17 (88%) Frame = -2 Query: 759 SWVTPGFXQSRRCKXTA 709 SWVTPGF QSRRCK TA Sbjct: 53 SWVTPGFSQSRRCKTTA 69 >SB_7005| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 67 Score = 37.5 bits (83), Expect = 0.012 Identities = 15/17 (88%), Positives = 15/17 (88%) Frame = -2 Query: 759 SWVTPGFXQSRRCKXTA 709 SWVTPGF QSRRCK TA Sbjct: 31 SWVTPGFSQSRRCKTTA 47 >SB_6796| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 925 Score = 37.5 bits (83), Expect = 0.012 Identities = 15/17 (88%), Positives = 15/17 (88%) Frame = -2 Query: 759 SWVTPGFXQSRRCKXTA 709 SWVTPGF QSRRCK TA Sbjct: 560 SWVTPGFSQSRRCKTTA 576 >SB_6339| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 114 Score = 37.5 bits (83), Expect = 0.012 Identities = 15/17 (88%), Positives = 15/17 (88%) Frame = -2 Query: 759 SWVTPGFXQSRRCKXTA 709 SWVTPGF QSRRCK TA Sbjct: 80 SWVTPGFSQSRRCKTTA 96 >SB_6047| Best HMM Match : CXC (HMM E-Value=7.7) Length = 90 Score = 37.5 bits (83), Expect = 0.012 Identities = 15/17 (88%), Positives = 15/17 (88%) Frame = -2 Query: 759 SWVTPGFXQSRRCKXTA 709 SWVTPGF QSRRCK TA Sbjct: 31 SWVTPGFSQSRRCKTTA 47 >SB_5753| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 73 Score = 37.5 bits (83), Expect = 0.012 Identities = 15/17 (88%), Positives = 15/17 (88%) Frame = -2 Query: 759 SWVTPGFXQSRRCKXTA 709 SWVTPGF QSRRCK TA Sbjct: 31 SWVTPGFSQSRRCKTTA 47 >SB_5503| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 92 Score = 37.5 bits (83), Expect = 0.012 Identities = 15/17 (88%), Positives = 15/17 (88%) Frame = -2 Query: 759 SWVTPGFXQSRRCKXTA 709 SWVTPGF QSRRCK TA Sbjct: 31 SWVTPGFSQSRRCKTTA 47 >SB_5427| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 374 Score = 37.5 bits (83), Expect = 0.012 Identities = 15/17 (88%), Positives = 15/17 (88%) Frame = -2 Query: 759 SWVTPGFXQSRRCKXTA 709 SWVTPGF QSRRCK TA Sbjct: 31 SWVTPGFSQSRRCKTTA 47 >SB_4286| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 69 Score = 37.5 bits (83), Expect = 0.012 Identities = 15/17 (88%), Positives = 15/17 (88%) Frame = -2 Query: 759 SWVTPGFXQSRRCKXTA 709 SWVTPGF QSRRCK TA Sbjct: 31 SWVTPGFSQSRRCKTTA 47 >SB_4268| Best HMM Match : MtrG (HMM E-Value=1.2) Length = 542 Score = 37.5 bits (83), Expect = 0.012 Identities = 15/17 (88%), Positives = 15/17 (88%) Frame = -2 Query: 759 SWVTPGFXQSRRCKXTA 709 SWVTPGF QSRRCK TA Sbjct: 185 SWVTPGFSQSRRCKTTA 201 >SB_4192| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 62 Score = 37.5 bits (83), Expect = 0.012 Identities = 15/17 (88%), Positives = 15/17 (88%) Frame = -2 Query: 759 SWVTPGFXQSRRCKXTA 709 SWVTPGF QSRRCK TA Sbjct: 31 SWVTPGFSQSRRCKTTA 47 >SB_3720| Best HMM Match : RVT_1 (HMM E-Value=0.0031) Length = 546 Score = 37.5 bits (83), Expect = 0.012 Identities = 15/17 (88%), Positives = 15/17 (88%) Frame = -2 Query: 759 SWVTPGFXQSRRCKXTA 709 SWVTPGF QSRRCK TA Sbjct: 31 SWVTPGFSQSRRCKTTA 47 >SB_3671| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 159 Score = 37.5 bits (83), Expect = 0.012 Identities = 15/17 (88%), Positives = 15/17 (88%) Frame = -2 Query: 759 SWVTPGFXQSRRCKXTA 709 SWVTPGF QSRRCK TA Sbjct: 53 SWVTPGFSQSRRCKTTA 69 >SB_2384| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 132 Score = 37.5 bits (83), Expect = 0.012 Identities = 15/17 (88%), Positives = 15/17 (88%) Frame = -2 Query: 759 SWVTPGFXQSRRCKXTA 709 SWVTPGF QSRRCK TA Sbjct: 53 SWVTPGFSQSRRCKTTA 69 >SB_1609| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 65 Score = 37.5 bits (83), Expect = 0.012 Identities = 15/17 (88%), Positives = 15/17 (88%) Frame = -2 Query: 759 SWVTPGFXQSRRCKXTA 709 SWVTPGF QSRRCK TA Sbjct: 31 SWVTPGFSQSRRCKTTA 47 >SB_751| Best HMM Match : rve (HMM E-Value=7.5e-12) Length = 338 Score = 37.5 bits (83), Expect = 0.012 Identities = 15/17 (88%), Positives = 15/17 (88%) Frame = -2 Query: 759 SWVTPGFXQSRRCKXTA 709 SWVTPGF QSRRCK TA Sbjct: 53 SWVTPGFSQSRRCKTTA 69 >SB_266| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 155 Score = 37.5 bits (83), Expect = 0.012 Identities = 15/17 (88%), Positives = 15/17 (88%) Frame = -2 Query: 759 SWVTPGFXQSRRCKXTA 709 SWVTPGF QSRRCK TA Sbjct: 31 SWVTPGFSQSRRCKTTA 47 >SB_59| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 133 Score = 37.5 bits (83), Expect = 0.012 Identities = 15/17 (88%), Positives = 15/17 (88%) Frame = -2 Query: 759 SWVTPGFXQSRRCKXTA 709 SWVTPGF QSRRCK TA Sbjct: 31 SWVTPGFSQSRRCKTTA 47 >SB_58440| Best HMM Match : Ribosomal_L9_C (HMM E-Value=0.81) Length = 427 Score = 37.5 bits (83), Expect = 0.012 Identities = 15/17 (88%), Positives = 15/17 (88%) Frame = -2 Query: 759 SWVTPGFXQSRRCKXTA 709 SWVTPGF QSRRCK TA Sbjct: 53 SWVTPGFSQSRRCKTTA 69 >SB_58394| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 65 Score = 37.5 bits (83), Expect = 0.012 Identities = 15/17 (88%), Positives = 15/17 (88%) Frame = -2 Query: 759 SWVTPGFXQSRRCKXTA 709 SWVTPGF QSRRCK TA Sbjct: 31 SWVTPGFSQSRRCKTTA 47 >SB_57506| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 77 Score = 37.5 bits (83), Expect = 0.012 Identities = 15/17 (88%), Positives = 15/17 (88%) Frame = -2 Query: 759 SWVTPGFXQSRRCKXTA 709 SWVTPGF QSRRCK TA Sbjct: 31 SWVTPGFSQSRRCKTTA 47 >SB_57021| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 72 Score = 37.5 bits (83), Expect = 0.012 Identities = 15/17 (88%), Positives = 15/17 (88%) Frame = -2 Query: 759 SWVTPGFXQSRRCKXTA 709 SWVTPGF QSRRCK TA Sbjct: 31 SWVTPGFSQSRRCKTTA 47 >SB_56970| Best HMM Match : Thaumatin (HMM E-Value=5.4) Length = 200 Score = 37.5 bits (83), Expect = 0.012 Identities = 15/17 (88%), Positives = 15/17 (88%) Frame = -2 Query: 759 SWVTPGFXQSRRCKXTA 709 SWVTPGF QSRRCK TA Sbjct: 53 SWVTPGFSQSRRCKTTA 69 >SB_56955| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 87 Score = 37.5 bits (83), Expect = 0.012 Identities = 15/17 (88%), Positives = 15/17 (88%) Frame = -2 Query: 759 SWVTPGFXQSRRCKXTA 709 SWVTPGF QSRRCK TA Sbjct: 45 SWVTPGFSQSRRCKTTA 61 >SB_56767| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 70 Score = 37.5 bits (83), Expect = 0.012 Identities = 15/17 (88%), Positives = 15/17 (88%) Frame = -2 Query: 759 SWVTPGFXQSRRCKXTA 709 SWVTPGF QSRRCK TA Sbjct: 31 SWVTPGFSQSRRCKTTA 47 >SB_56729| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 71 Score = 37.5 bits (83), Expect = 0.012 Identities = 15/17 (88%), Positives = 15/17 (88%) Frame = -2 Query: 759 SWVTPGFXQSRRCKXTA 709 SWVTPGF QSRRCK TA Sbjct: 31 SWVTPGFSQSRRCKTTA 47 >SB_56672| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 75 Score = 37.5 bits (83), Expect = 0.012 Identities = 15/17 (88%), Positives = 15/17 (88%) Frame = -2 Query: 759 SWVTPGFXQSRRCKXTA 709 SWVTPGF QSRRCK TA Sbjct: 31 SWVTPGFSQSRRCKTTA 47 >SB_56555| Best HMM Match : 7tm_1 (HMM E-Value=4.4) Length = 220 Score = 37.5 bits (83), Expect = 0.012 Identities = 15/17 (88%), Positives = 15/17 (88%) Frame = -2 Query: 759 SWVTPGFXQSRRCKXTA 709 SWVTPGF QSRRCK TA Sbjct: 31 SWVTPGFSQSRRCKTTA 47 >SB_56358| Best HMM Match : Fork_head (HMM E-Value=1.2e-30) Length = 289 Score = 37.5 bits (83), Expect = 0.012 Identities = 15/17 (88%), Positives = 15/17 (88%) Frame = -2 Query: 759 SWVTPGFXQSRRCKXTA 709 SWVTPGF QSRRCK TA Sbjct: 270 SWVTPGFSQSRRCKTTA 286 >SB_56099| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 136 Score = 37.5 bits (83), Expect = 0.012 Identities = 15/17 (88%), Positives = 15/17 (88%) Frame = -2 Query: 759 SWVTPGFXQSRRCKXTA 709 SWVTPGF QSRRCK TA Sbjct: 31 SWVTPGFSQSRRCKTTA 47 >SB_56058| Best HMM Match : Phasin (HMM E-Value=2.7) Length = 314 Score = 37.5 bits (83), Expect = 0.012 Identities = 15/17 (88%), Positives = 15/17 (88%) Frame = -2 Query: 759 SWVTPGFXQSRRCKXTA 709 SWVTPGF QSRRCK TA Sbjct: 295 SWVTPGFSQSRRCKTTA 311 >SB_55954| Best HMM Match : TIL (HMM E-Value=0.74) Length = 172 Score = 37.5 bits (83), Expect = 0.012 Identities = 15/17 (88%), Positives = 15/17 (88%) Frame = -2 Query: 759 SWVTPGFXQSRRCKXTA 709 SWVTPGF QSRRCK TA Sbjct: 53 SWVTPGFSQSRRCKTTA 69 >SB_55182| Best HMM Match : T4_deiodinase (HMM E-Value=0) Length = 446 Score = 37.5 bits (83), Expect = 0.012 Identities = 15/17 (88%), Positives = 15/17 (88%) Frame = -2 Query: 759 SWVTPGFXQSRRCKXTA 709 SWVTPGF QSRRCK TA Sbjct: 68 SWVTPGFSQSRRCKTTA 84 >SB_55138| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 165 Score = 37.5 bits (83), Expect = 0.012 Identities = 15/17 (88%), Positives = 15/17 (88%) Frame = -2 Query: 759 SWVTPGFXQSRRCKXTA 709 SWVTPGF QSRRCK TA Sbjct: 31 SWVTPGFSQSRRCKTTA 47 >SB_55112| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 67 Score = 37.5 bits (83), Expect = 0.012 Identities = 15/17 (88%), Positives = 15/17 (88%) Frame = -2 Query: 759 SWVTPGFXQSRRCKXTA 709 SWVTPGF QSRRCK TA Sbjct: 31 SWVTPGFSQSRRCKTTA 47 >SB_54421| Best HMM Match : HipA_C (HMM E-Value=7.5) Length = 248 Score = 37.5 bits (83), Expect = 0.012 Identities = 15/17 (88%), Positives = 15/17 (88%) Frame = -2 Query: 759 SWVTPGFXQSRRCKXTA 709 SWVTPGF QSRRCK TA Sbjct: 53 SWVTPGFSQSRRCKTTA 69 >SB_54343| Best HMM Match : TipAS (HMM E-Value=0.77) Length = 316 Score = 37.5 bits (83), Expect = 0.012 Identities = 15/17 (88%), Positives = 15/17 (88%) Frame = -2 Query: 759 SWVTPGFXQSRRCKXTA 709 SWVTPGF QSRRCK TA Sbjct: 31 SWVTPGFSQSRRCKTTA 47 >SB_54153| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 79 Score = 37.5 bits (83), Expect = 0.012 Identities = 15/17 (88%), Positives = 15/17 (88%) Frame = -2 Query: 759 SWVTPGFXQSRRCKXTA 709 SWVTPGF QSRRCK TA Sbjct: 31 SWVTPGFSQSRRCKTTA 47 >SB_54005| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 74 Score = 37.5 bits (83), Expect = 0.012 Identities = 15/17 (88%), Positives = 15/17 (88%) Frame = -2 Query: 759 SWVTPGFXQSRRCKXTA 709 SWVTPGF QSRRCK TA Sbjct: 31 SWVTPGFSQSRRCKTTA 47 >SB_53974| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 69 Score = 37.5 bits (83), Expect = 0.012 Identities = 15/17 (88%), Positives = 15/17 (88%) Frame = -2 Query: 759 SWVTPGFXQSRRCKXTA 709 SWVTPGF QSRRCK TA Sbjct: 31 SWVTPGFSQSRRCKTTA 47 >SB_53662| Best HMM Match : Protamine_P2 (HMM E-Value=9.2) Length = 253 Score = 37.5 bits (83), Expect = 0.012 Identities = 15/17 (88%), Positives = 15/17 (88%) Frame = -2 Query: 759 SWVTPGFXQSRRCKXTA 709 SWVTPGF QSRRCK TA Sbjct: 222 SWVTPGFSQSRRCKTTA 238 >SB_53598| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 196 Score = 37.5 bits (83), Expect = 0.012 Identities = 15/17 (88%), Positives = 15/17 (88%) Frame = -2 Query: 759 SWVTPGFXQSRRCKXTA 709 SWVTPGF QSRRCK TA Sbjct: 158 SWVTPGFSQSRRCKTTA 174 >SB_53044| Best HMM Match : TcpA (HMM E-Value=3.1) Length = 195 Score = 37.5 bits (83), Expect = 0.012 Identities = 15/17 (88%), Positives = 15/17 (88%) Frame = -2 Query: 759 SWVTPGFXQSRRCKXTA 709 SWVTPGF QSRRCK TA Sbjct: 53 SWVTPGFSQSRRCKTTA 69 >SB_52956| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 70 Score = 37.5 bits (83), Expect = 0.012 Identities = 15/17 (88%), Positives = 15/17 (88%) Frame = -2 Query: 759 SWVTPGFXQSRRCKXTA 709 SWVTPGF QSRRCK TA Sbjct: 31 SWVTPGFSQSRRCKTTA 47 >SB_52523| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 498 Score = 37.5 bits (83), Expect = 0.012 Identities = 15/17 (88%), Positives = 15/17 (88%) Frame = -2 Query: 759 SWVTPGFXQSRRCKXTA 709 SWVTPGF QSRRCK TA Sbjct: 479 SWVTPGFSQSRRCKTTA 495 >SB_51739| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 191 Score = 37.5 bits (83), Expect = 0.012 Identities = 15/17 (88%), Positives = 15/17 (88%) Frame = -2 Query: 759 SWVTPGFXQSRRCKXTA 709 SWVTPGF QSRRCK TA Sbjct: 31 SWVTPGFSQSRRCKTTA 47 >SB_51732| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 81 Score = 37.5 bits (83), Expect = 0.012 Identities = 15/17 (88%), Positives = 15/17 (88%) Frame = -2 Query: 759 SWVTPGFXQSRRCKXTA 709 SWVTPGF QSRRCK TA Sbjct: 31 SWVTPGFSQSRRCKTTA 47 >SB_51109| Best HMM Match : ATP-cone (HMM E-Value=0.76) Length = 250 Score = 37.5 bits (83), Expect = 0.012 Identities = 15/17 (88%), Positives = 15/17 (88%) Frame = -2 Query: 759 SWVTPGFXQSRRCKXTA 709 SWVTPGF QSRRCK TA Sbjct: 31 SWVTPGFSQSRRCKTTA 47 >SB_50972| Best HMM Match : MH1 (HMM E-Value=7.1) Length = 283 Score = 37.5 bits (83), Expect = 0.012 Identities = 15/17 (88%), Positives = 15/17 (88%) Frame = -2 Query: 759 SWVTPGFXQSRRCKXTA 709 SWVTPGF QSRRCK TA Sbjct: 129 SWVTPGFSQSRRCKTTA 145 >SB_50818| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 109 Score = 37.5 bits (83), Expect = 0.012 Identities = 15/17 (88%), Positives = 15/17 (88%) Frame = -2 Query: 759 SWVTPGFXQSRRCKXTA 709 SWVTPGF QSRRCK TA Sbjct: 53 SWVTPGFSQSRRCKTTA 69 >SB_50491| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 55 Score = 37.5 bits (83), Expect = 0.012 Identities = 15/17 (88%), Positives = 15/17 (88%) Frame = -2 Query: 759 SWVTPGFXQSRRCKXTA 709 SWVTPGF QSRRCK TA Sbjct: 31 SWVTPGFSQSRRCKTTA 47 >SB_50286| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 64 Score = 37.5 bits (83), Expect = 0.012 Identities = 15/17 (88%), Positives = 15/17 (88%) Frame = -2 Query: 759 SWVTPGFXQSRRCKXTA 709 SWVTPGF QSRRCK TA Sbjct: 31 SWVTPGFSQSRRCKTTA 47 >SB_50222| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 167 Score = 37.5 bits (83), Expect = 0.012 Identities = 15/17 (88%), Positives = 15/17 (88%) Frame = -2 Query: 759 SWVTPGFXQSRRCKXTA 709 SWVTPGF QSRRCK TA Sbjct: 53 SWVTPGFSQSRRCKTTA 69 >SB_50081| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 63 Score = 37.5 bits (83), Expect = 0.012 Identities = 15/17 (88%), Positives = 15/17 (88%) Frame = -2 Query: 759 SWVTPGFXQSRRCKXTA 709 SWVTPGF QSRRCK TA Sbjct: 31 SWVTPGFSQSRRCKTTA 47 >SB_50019| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 849 Score = 37.5 bits (83), Expect = 0.012 Identities = 15/17 (88%), Positives = 15/17 (88%) Frame = -2 Query: 759 SWVTPGFXQSRRCKXTA 709 SWVTPGF QSRRCK TA Sbjct: 85 SWVTPGFSQSRRCKTTA 101 >SB_49981| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 82 Score = 37.5 bits (83), Expect = 0.012 Identities = 15/17 (88%), Positives = 15/17 (88%) Frame = -2 Query: 759 SWVTPGFXQSRRCKXTA 709 SWVTPGF QSRRCK TA Sbjct: 31 SWVTPGFSQSRRCKTTA 47 >SB_49899| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 122 Score = 37.5 bits (83), Expect = 0.012 Identities = 15/17 (88%), Positives = 15/17 (88%) Frame = -2 Query: 759 SWVTPGFXQSRRCKXTA 709 SWVTPGF QSRRCK TA Sbjct: 53 SWVTPGFSQSRRCKTTA 69 >SB_49895| Best HMM Match : NACHT (HMM E-Value=7.7) Length = 144 Score = 37.5 bits (83), Expect = 0.012 Identities = 15/17 (88%), Positives = 15/17 (88%) Frame = -2 Query: 759 SWVTPGFXQSRRCKXTA 709 SWVTPGF QSRRCK TA Sbjct: 53 SWVTPGFSQSRRCKTTA 69 >SB_49629| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 224 Score = 37.5 bits (83), Expect = 0.012 Identities = 15/17 (88%), Positives = 15/17 (88%) Frame = -2 Query: 759 SWVTPGFXQSRRCKXTA 709 SWVTPGF QSRRCK TA Sbjct: 53 SWVTPGFSQSRRCKTTA 69 >SB_48632| Best HMM Match : DUF265 (HMM E-Value=7.6e-22) Length = 455 Score = 37.5 bits (83), Expect = 0.012 Identities = 15/17 (88%), Positives = 15/17 (88%) Frame = -2 Query: 759 SWVTPGFXQSRRCKXTA 709 SWVTPGF QSRRCK TA Sbjct: 148 SWVTPGFSQSRRCKTTA 164 >SB_47940| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 85 Score = 37.5 bits (83), Expect = 0.012 Identities = 15/17 (88%), Positives = 15/17 (88%) Frame = -2 Query: 759 SWVTPGFXQSRRCKXTA 709 SWVTPGF QSRRCK TA Sbjct: 31 SWVTPGFSQSRRCKTTA 47 >SB_47474| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 65 Score = 37.5 bits (83), Expect = 0.012 Identities = 15/17 (88%), Positives = 15/17 (88%) Frame = -2 Query: 759 SWVTPGFXQSRRCKXTA 709 SWVTPGF QSRRCK TA Sbjct: 31 SWVTPGFSQSRRCKTTA 47 >SB_47304| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 92 Score = 37.5 bits (83), Expect = 0.012 Identities = 15/17 (88%), Positives = 15/17 (88%) Frame = -2 Query: 759 SWVTPGFXQSRRCKXTA 709 SWVTPGF QSRRCK TA Sbjct: 31 SWVTPGFSQSRRCKTTA 47 >SB_47265| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 62 Score = 37.5 bits (83), Expect = 0.012 Identities = 15/17 (88%), Positives = 15/17 (88%) Frame = -2 Query: 759 SWVTPGFXQSRRCKXTA 709 SWVTPGF QSRRCK TA Sbjct: 31 SWVTPGFSQSRRCKTTA 47 >SB_47031| Best HMM Match : Protamine_P1 (HMM E-Value=7) Length = 128 Score = 37.5 bits (83), Expect = 0.012 Identities = 15/17 (88%), Positives = 15/17 (88%) Frame = -2 Query: 759 SWVTPGFXQSRRCKXTA 709 SWVTPGF QSRRCK TA Sbjct: 31 SWVTPGFSQSRRCKTTA 47 >SB_46830| Best HMM Match : Succ_DH_flav_C (HMM E-Value=3.2e-37) Length = 333 Score = 37.5 bits (83), Expect = 0.012 Identities = 15/17 (88%), Positives = 15/17 (88%) Frame = -2 Query: 759 SWVTPGFXQSRRCKXTA 709 SWVTPGF QSRRCK TA Sbjct: 314 SWVTPGFSQSRRCKTTA 330 >SB_46484| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 117 Score = 37.5 bits (83), Expect = 0.012 Identities = 15/17 (88%), Positives = 15/17 (88%) Frame = -2 Query: 759 SWVTPGFXQSRRCKXTA 709 SWVTPGF QSRRCK TA Sbjct: 53 SWVTPGFSQSRRCKTTA 69 >SB_46118| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 60 Score = 37.5 bits (83), Expect = 0.012 Identities = 15/17 (88%), Positives = 15/17 (88%) Frame = -2 Query: 759 SWVTPGFXQSRRCKXTA 709 SWVTPGF QSRRCK TA Sbjct: 24 SWVTPGFSQSRRCKTTA 40 >SB_45749| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 125 Score = 37.5 bits (83), Expect = 0.012 Identities = 15/17 (88%), Positives = 15/17 (88%) Frame = -2 Query: 759 SWVTPGFXQSRRCKXTA 709 SWVTPGF QSRRCK TA Sbjct: 31 SWVTPGFSQSRRCKTTA 47 >SB_45575| Best HMM Match : Keratin_B2 (HMM E-Value=8.8) Length = 271 Score = 37.5 bits (83), Expect = 0.012 Identities = 15/17 (88%), Positives = 15/17 (88%) Frame = -2 Query: 759 SWVTPGFXQSRRCKXTA 709 SWVTPGF QSRRCK TA Sbjct: 31 SWVTPGFSQSRRCKTTA 47 >SB_45266| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 65 Score = 37.5 bits (83), Expect = 0.012 Identities = 15/17 (88%), Positives = 15/17 (88%) Frame = -2 Query: 759 SWVTPGFXQSRRCKXTA 709 SWVTPGF QSRRCK TA Sbjct: 31 SWVTPGFSQSRRCKTTA 47 >SB_44239| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 82 Score = 37.5 bits (83), Expect = 0.012 Identities = 15/17 (88%), Positives = 15/17 (88%) Frame = -2 Query: 759 SWVTPGFXQSRRCKXTA 709 SWVTPGF QSRRCK TA Sbjct: 31 SWVTPGFSQSRRCKTTA 47 >SB_44171| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 83 Score = 37.5 bits (83), Expect = 0.012 Identities = 15/17 (88%), Positives = 15/17 (88%) Frame = -2 Query: 759 SWVTPGFXQSRRCKXTA 709 SWVTPGF QSRRCK TA Sbjct: 31 SWVTPGFSQSRRCKTTA 47 >SB_44073| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 65 Score = 37.5 bits (83), Expect = 0.012 Identities = 15/17 (88%), Positives = 15/17 (88%) Frame = -2 Query: 759 SWVTPGFXQSRRCKXTA 709 SWVTPGF QSRRCK TA Sbjct: 31 SWVTPGFSQSRRCKTTA 47 >SB_43825| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 137 Score = 37.5 bits (83), Expect = 0.012 Identities = 15/17 (88%), Positives = 15/17 (88%) Frame = -2 Query: 759 SWVTPGFXQSRRCKXTA 709 SWVTPGF QSRRCK TA Sbjct: 45 SWVTPGFSQSRRCKTTA 61 >SB_43752| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 78 Score = 37.5 bits (83), Expect = 0.012 Identities = 15/17 (88%), Positives = 15/17 (88%) Frame = -2 Query: 759 SWVTPGFXQSRRCKXTA 709 SWVTPGF QSRRCK TA Sbjct: 31 SWVTPGFSQSRRCKTTA 47 >SB_43722| Best HMM Match : TPR_4 (HMM E-Value=0.69) Length = 199 Score = 37.5 bits (83), Expect = 0.012 Identities = 15/17 (88%), Positives = 15/17 (88%) Frame = -2 Query: 759 SWVTPGFXQSRRCKXTA 709 SWVTPGF QSRRCK TA Sbjct: 53 SWVTPGFSQSRRCKTTA 69 >SB_42847| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 60 Score = 37.5 bits (83), Expect = 0.012 Identities = 15/17 (88%), Positives = 15/17 (88%) Frame = -2 Query: 759 SWVTPGFXQSRRCKXTA 709 SWVTPGF QSRRCK TA Sbjct: 24 SWVTPGFSQSRRCKTTA 40 >SB_42555| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 62 Score = 37.5 bits (83), Expect = 0.012 Identities = 15/17 (88%), Positives = 15/17 (88%) Frame = -2 Query: 759 SWVTPGFXQSRRCKXTA 709 SWVTPGF QSRRCK TA Sbjct: 31 SWVTPGFSQSRRCKTTA 47 >SB_42300| Best HMM Match : Filament_head (HMM E-Value=4.9) Length = 152 Score = 37.5 bits (83), Expect = 0.012 Identities = 15/17 (88%), Positives = 15/17 (88%) Frame = -2 Query: 759 SWVTPGFXQSRRCKXTA 709 SWVTPGF QSRRCK TA Sbjct: 53 SWVTPGFSQSRRCKTTA 69 >SB_42133| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 180 Score = 37.5 bits (83), Expect = 0.012 Identities = 15/17 (88%), Positives = 15/17 (88%) Frame = -2 Query: 759 SWVTPGFXQSRRCKXTA 709 SWVTPGF QSRRCK TA Sbjct: 53 SWVTPGFSQSRRCKTTA 69 >SB_42128| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 183 Score = 37.5 bits (83), Expect = 0.012 Identities = 15/17 (88%), Positives = 15/17 (88%) Frame = -2 Query: 759 SWVTPGFXQSRRCKXTA 709 SWVTPGF QSRRCK TA Sbjct: 164 SWVTPGFSQSRRCKTTA 180 >SB_41545| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 101 Score = 37.5 bits (83), Expect = 0.012 Identities = 15/17 (88%), Positives = 15/17 (88%) Frame = -2 Query: 759 SWVTPGFXQSRRCKXTA 709 SWVTPGF QSRRCK TA Sbjct: 31 SWVTPGFSQSRRCKTTA 47 >SB_41358| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 135 Score = 37.5 bits (83), Expect = 0.012 Identities = 15/17 (88%), Positives = 15/17 (88%) Frame = -2 Query: 759 SWVTPGFXQSRRCKXTA 709 SWVTPGF QSRRCK TA Sbjct: 53 SWVTPGFSQSRRCKTTA 69 >SB_41085| Best HMM Match : Auxin_repressed (HMM E-Value=9) Length = 206 Score = 37.5 bits (83), Expect = 0.012 Identities = 15/17 (88%), Positives = 15/17 (88%) Frame = -2 Query: 759 SWVTPGFXQSRRCKXTA 709 SWVTPGF QSRRCK TA Sbjct: 53 SWVTPGFSQSRRCKTTA 69 >SB_40884| Best HMM Match : Homeobox (HMM E-Value=0.068) Length = 229 Score = 37.5 bits (83), Expect = 0.012 Identities = 15/17 (88%), Positives = 15/17 (88%) Frame = -2 Query: 759 SWVTPGFXQSRRCKXTA 709 SWVTPGF QSRRCK TA Sbjct: 31 SWVTPGFSQSRRCKTTA 47 >SB_40300| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 97 Score = 37.5 bits (83), Expect = 0.012 Identities = 15/17 (88%), Positives = 15/17 (88%) Frame = -2 Query: 759 SWVTPGFXQSRRCKXTA 709 SWVTPGF QSRRCK TA Sbjct: 31 SWVTPGFSQSRRCKTTA 47 >SB_40139| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 57 Score = 37.5 bits (83), Expect = 0.012 Identities = 15/17 (88%), Positives = 15/17 (88%) Frame = -2 Query: 759 SWVTPGFXQSRRCKXTA 709 SWVTPGF QSRRCK TA Sbjct: 38 SWVTPGFSQSRRCKTTA 54 >SB_39508| Best HMM Match : F5_F8_type_C (HMM E-Value=0) Length = 1814 Score = 37.5 bits (83), Expect = 0.012 Identities = 15/17 (88%), Positives = 15/17 (88%) Frame = -2 Query: 759 SWVTPGFXQSRRCKXTA 709 SWVTPGF QSRRCK TA Sbjct: 723 SWVTPGFSQSRRCKTTA 739 >SB_39391| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 376 Score = 37.5 bits (83), Expect = 0.012 Identities = 15/17 (88%), Positives = 15/17 (88%) Frame = -2 Query: 759 SWVTPGFXQSRRCKXTA 709 SWVTPGF QSRRCK TA Sbjct: 357 SWVTPGFSQSRRCKTTA 373 >SB_39208| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 37.5 bits (83), Expect = 0.012 Identities = 15/17 (88%), Positives = 15/17 (88%) Frame = -2 Query: 759 SWVTPGFXQSRRCKXTA 709 SWVTPGF QSRRCK TA Sbjct: 53 SWVTPGFSQSRRCKTTA 69 >SB_38658| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 95 Score = 37.5 bits (83), Expect = 0.012 Identities = 15/17 (88%), Positives = 15/17 (88%) Frame = -2 Query: 759 SWVTPGFXQSRRCKXTA 709 SWVTPGF QSRRCK TA Sbjct: 31 SWVTPGFSQSRRCKTTA 47 >SB_38558| Best HMM Match : TFIIA_gamma_N (HMM E-Value=7.4) Length = 164 Score = 37.5 bits (83), Expect = 0.012 Identities = 15/17 (88%), Positives = 15/17 (88%) Frame = -2 Query: 759 SWVTPGFXQSRRCKXTA 709 SWVTPGF QSRRCK TA Sbjct: 53 SWVTPGFSQSRRCKTTA 69 >SB_38521| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 506 Score = 37.5 bits (83), Expect = 0.012 Identities = 15/17 (88%), Positives = 15/17 (88%) Frame = -2 Query: 759 SWVTPGFXQSRRCKXTA 709 SWVTPGF QSRRCK TA Sbjct: 142 SWVTPGFSQSRRCKTTA 158 >SB_38282| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 62 Score = 37.5 bits (83), Expect = 0.012 Identities = 15/17 (88%), Positives = 15/17 (88%) Frame = -2 Query: 759 SWVTPGFXQSRRCKXTA 709 SWVTPGF QSRRCK TA Sbjct: 31 SWVTPGFSQSRRCKTTA 47 >SB_38080| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 64 Score = 37.5 bits (83), Expect = 0.012 Identities = 15/17 (88%), Positives = 15/17 (88%) Frame = -2 Query: 759 SWVTPGFXQSRRCKXTA 709 SWVTPGF QSRRCK TA Sbjct: 31 SWVTPGFSQSRRCKTTA 47 >SB_37703| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 62 Score = 37.5 bits (83), Expect = 0.012 Identities = 15/17 (88%), Positives = 15/17 (88%) Frame = -2 Query: 759 SWVTPGFXQSRRCKXTA 709 SWVTPGF QSRRCK TA Sbjct: 31 SWVTPGFSQSRRCKTTA 47 >SB_37072| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 66 Score = 37.5 bits (83), Expect = 0.012 Identities = 15/17 (88%), Positives = 15/17 (88%) Frame = -2 Query: 759 SWVTPGFXQSRRCKXTA 709 SWVTPGF QSRRCK TA Sbjct: 31 SWVTPGFSQSRRCKTTA 47 >SB_36830| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 163 Score = 37.5 bits (83), Expect = 0.012 Identities = 15/17 (88%), Positives = 15/17 (88%) Frame = -2 Query: 759 SWVTPGFXQSRRCKXTA 709 SWVTPGF QSRRCK TA Sbjct: 31 SWVTPGFSQSRRCKTTA 47 >SB_36723| Best HMM Match : DUF753 (HMM E-Value=9.9) Length = 130 Score = 37.5 bits (83), Expect = 0.012 Identities = 15/17 (88%), Positives = 15/17 (88%) Frame = -2 Query: 759 SWVTPGFXQSRRCKXTA 709 SWVTPGF QSRRCK TA Sbjct: 53 SWVTPGFSQSRRCKTTA 69 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 19,273,498 Number of Sequences: 59808 Number of extensions: 335822 Number of successful extensions: 5026 Number of sequences better than 10.0: 500 Number of HSP's better than 10.0 without gapping: 3453 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 5022 length of database: 16,821,457 effective HSP length: 80 effective length of database: 12,036,817 effective search space used: 2070332524 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -