BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= brP-0185 (730 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_48082| Best HMM Match : No HMM Matches (HMM E-Value=.) 101 6e-22 SB_3986| Best HMM Match : C2 (HMM E-Value=2.9e-31) 71 1e-12 SB_32476| Best HMM Match : Ion_trans (HMM E-Value=1.7e-36) 31 1.3 SB_3985| Best HMM Match : C2 (HMM E-Value=0) 30 1.7 SB_2931| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 2.2 SB_22002| Best HMM Match : zf-C2H2 (HMM E-Value=1.7e-25) 29 3.9 SB_386| Best HMM Match : zf-C2H2 (HMM E-Value=1.7e-25) 29 3.9 SB_58127| Best HMM Match : DUF1605 (HMM E-Value=0.17) 29 5.1 SB_21384| Best HMM Match : 7tm_1 (HMM E-Value=8.6e-05) 28 8.9 SB_18018| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 8.9 SB_48173| Best HMM Match : WD40 (HMM E-Value=7.3e-18) 28 8.9 SB_29730| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 8.9 >SB_48082| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 665 Score = 101 bits (242), Expect = 6e-22 Identities = 46/144 (31%), Positives = 84/144 (58%), Gaps = 1/144 (0%) Frame = +3 Query: 300 VFSMMYTFLKKVSIVGAVYLVGYMQWSVAWLIGPVILSVMRDQWRKENEYK-RNIAKVAA 476 + + + +LK V + ++ +G+M S W++ +++ M W+ E K + AK+ Sbjct: 45 IVTFVLKYLKFVGVALGIWFMGWMGLSYVWVLCGLLVFTM---WKLNQEDKSKRRAKLQE 101 Query: 477 LSSEKDVILARLDDLPSWVFFPDVERAEWLNRILLQVWPNVNSYAKTLLXDLIEPAVAXS 656 + I+A++DDLP+WVFFPDVERAEWLN++++Q+WP +N ++ + +EP + + Sbjct: 102 VMKTDSEIVAKMDDLPAWVFFPDVERAEWLNKMIVQLWPFINDMVVKIMKETVEPEIQKN 161 Query: 657 LANYKLSGFKFERMILGTIAPRVG 728 + + L F + LG PR+G Sbjct: 162 VPGF-LKSIHFAEISLGNQPPRIG 184 >SB_3986| Best HMM Match : C2 (HMM E-Value=2.9e-31) Length = 778 Score = 70.9 bits (166), Expect = 1e-12 Identities = 44/135 (32%), Positives = 64/135 (47%) Frame = +3 Query: 303 FSMMYTFLKKVSIVGAVYLVGYMQWSVAWLIGPVILSVMRDQWRKENEYKRNIAKVAALS 482 FS +TFL + + G + S AWL+ + + KR I +V + Sbjct: 16 FSHFFTFLGWFVLAWIAWAFGALHLSFAWLVLFLFIGAFLQSGHLLKSNKRKIHRV--IK 73 Query: 483 SEKDVILARLDDLPSWVFFPDVERAEWLNRILLQVWPNVNSYAKTLLXDLIEPAVAXSLA 662 E DV ++PSW++F + E A WLNRIL Q+WP V + +L +EPA+ S Sbjct: 74 QENDVKKV-WPNMPSWIYFSEEEHALWLNRILDQMWPYVEDMVQGILKHSVEPAI-QSYL 131 Query: 663 NYKLSGFKFERMILG 707 L FE+M LG Sbjct: 132 PAPLQSLCFEKMALG 146 >SB_32476| Best HMM Match : Ion_trans (HMM E-Value=1.7e-36) Length = 454 Score = 30.7 bits (66), Expect = 1.3 Identities = 13/38 (34%), Positives = 27/38 (71%), Gaps = 2/38 (5%) Frame = +1 Query: 16 TLKGRIIISLLNLQAIKIVS--TVLCITNYEKILSTEC 123 T G+I+ S+L++ + +V+ L ++N++K+LST+C Sbjct: 343 TASGKIVGSILSVFGVLVVALPVFLFVSNFKKVLSTKC 380 >SB_3985| Best HMM Match : C2 (HMM E-Value=0) Length = 835 Score = 30.3 bits (65), Expect = 1.7 Identities = 17/52 (32%), Positives = 34/52 (65%), Gaps = 1/52 (1%) Frame = +3 Query: 348 AVYLVGYMQWSVAWLIGPVILSV-MRDQWRKENEYKRNIAKVAALSSEKDVI 500 A++LVGYM +S AW++ +++ V + + K+ +++ N+ + A +SS D I Sbjct: 117 ALWLVGYMHFSFAWIVMILMIFVSWQFEIEKKTKHRENMVQ-AHMSSYIDKI 167 >SB_2931| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 212 Score = 29.9 bits (64), Expect = 2.2 Identities = 17/53 (32%), Positives = 23/53 (43%) Frame = -1 Query: 547 TSGKNTHEGKSSSLASITSFSEDSAATFAMLRLYSFSLRH*SRITDNITGPIS 389 TS N EG ++SFSED + M R +F R+ +TG S Sbjct: 93 TSRTNEEEGVEKMQLLVSSFSEDQLNRYEMYRRAAFPKAAIKRLMQGVTGGTS 145 >SB_22002| Best HMM Match : zf-C2H2 (HMM E-Value=1.7e-25) Length = 431 Score = 29.1 bits (62), Expect = 3.9 Identities = 11/31 (35%), Positives = 18/31 (58%) Frame = -2 Query: 531 PMKASRQVSLVSHLFQKTVQRPLRCCVCIRS 439 P + SR L H+ T Q+P +C +C+R+ Sbjct: 311 PRRFSRSDELTRHMRTHTGQKPFQCRICMRN 341 >SB_386| Best HMM Match : zf-C2H2 (HMM E-Value=1.7e-25) Length = 669 Score = 29.1 bits (62), Expect = 3.9 Identities = 11/31 (35%), Positives = 18/31 (58%) Frame = -2 Query: 531 PMKASRQVSLVSHLFQKTVQRPLRCCVCIRS 439 P + SR L H+ T Q+P +C +C+R+ Sbjct: 549 PRRFSRSDELTRHMRTHTGQKPFQCRICMRN 579 >SB_58127| Best HMM Match : DUF1605 (HMM E-Value=0.17) Length = 231 Score = 28.7 bits (61), Expect = 5.1 Identities = 13/43 (30%), Positives = 20/43 (46%) Frame = -3 Query: 491 FFRRQCSDLCDVAFVFVLLAPLIAHHRQYNGPNKPRNAPLHIT 363 F+RR D CD AF+ + + + A + KP A I+ Sbjct: 160 FYRRFYQDFCDTAFIEIYIGVVTAQSMEKKHFKKPLKASFEIS 202 >SB_21384| Best HMM Match : 7tm_1 (HMM E-Value=8.6e-05) Length = 442 Score = 27.9 bits (59), Expect = 8.9 Identities = 15/39 (38%), Positives = 20/39 (51%) Frame = +2 Query: 359 SRLYAMERCVAYWARYIVGDARSMAQGERIQTQHRKGRC 475 +R Y M RYIVG+ +S++Q RI K RC Sbjct: 339 NRRYFMRESDINPERYIVGNNKSISQSPRILVPAAKPRC 377 >SB_18018| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1040 Score = 27.9 bits (59), Expect = 8.9 Identities = 13/28 (46%), Positives = 16/28 (57%) Frame = -2 Query: 270 RQFCLHLPCYYHWPCCTKLLRRCRCFRD 187 RQFC+H+P K L RC CFR+ Sbjct: 854 RQFCIHIP--------GKYLTRCECFRN 873 >SB_48173| Best HMM Match : WD40 (HMM E-Value=7.3e-18) Length = 659 Score = 27.9 bits (59), Expect = 8.9 Identities = 8/27 (29%), Positives = 20/27 (74%) Frame = +3 Query: 387 WLIGPVILSVMRDQWRKENEYKRNIAK 467 W + P +L+ +++Q++KE + K+N+ + Sbjct: 247 WDVDPSMLAKLKEQYKKERKSKKNVKR 273 >SB_29730| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 4275 Score = 27.9 bits (59), Expect = 8.9 Identities = 18/79 (22%), Positives = 39/79 (49%), Gaps = 1/79 (1%) Frame = +3 Query: 432 RKENEYKRNIAKVAALSSEKDVILARL-DDLPSWVFFPDVERAEWLNRILLQVWPNVNSY 608 R + ++++ + L + +D+ + L D+ + F P + +E L+++ W NVN Sbjct: 3494 RTDATSRKSLTLIKHLFNREDITTSPLLADIKNTKFVPPHKVSEALSQLCPPFWSNVNGG 3553 Query: 609 AKTLLXDLIEPAVAXSLAN 665 K +L +P V +A+ Sbjct: 3554 IKQMLGIYEKPPVEVVVAH 3572 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 22,578,120 Number of Sequences: 59808 Number of extensions: 486104 Number of successful extensions: 1444 Number of sequences better than 10.0: 12 Number of HSP's better than 10.0 without gapping: 1233 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1433 length of database: 16,821,457 effective HSP length: 80 effective length of database: 12,036,817 effective search space used: 1949964354 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -