BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= brP-0183 (800 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPAC664.01c |swi6|SPAC824.10c|chromodomain protein Swi6|Schizosa... 33 0.062 SPCC16A11.02 |utp13|SPCC63.16|U3 snoRNP-associated protein Utp13... 26 5.4 >SPAC664.01c |swi6|SPAC824.10c|chromodomain protein Swi6|Schizosaccharomyces pombe|chr 1|||Manual Length = 328 Score = 32.7 bits (71), Expect = 0.062 Identities = 11/23 (47%), Positives = 17/23 (73%) Frame = +3 Query: 513 PAKVANVKCPQQVIAFYEERLTW 581 P+ + N KCPQ+++ FYE LT+ Sbjct: 302 PSTITNKKCPQKMLQFYESHLTF 324 >SPCC16A11.02 |utp13|SPCC63.16|U3 snoRNP-associated protein Utp13 |Schizosaccharomyces pombe|chr 3|||Manual Length = 777 Score = 26.2 bits (55), Expect = 5.4 Identities = 18/49 (36%), Positives = 27/49 (55%) Frame = +3 Query: 429 EKIIGASDATGELMFLIKWTDSDEAELVPAKVANVKCPQQVIAFYEERL 575 ++IIG TGE +F IK DE + V A +A +++IA + RL Sbjct: 40 DRIIGTRSETGERLFSIK---KDEDDYVTA-LAITSDSKKLIAAFRSRL 84 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,232,225 Number of Sequences: 5004 Number of extensions: 33041 Number of successful extensions: 75 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 74 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 75 length of database: 2,362,478 effective HSP length: 72 effective length of database: 2,002,190 effective search space used: 388424860 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -