Bombyx BLAST Result against celegans

BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= brP-0181
         (723 letters)

Database: celegans 
           27,780 sequences; 12,740,198 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AC024845-1|AAF60850.2|  347|Caenorhabditis elegans Hypothetical ...    29   4.4  

>AC024845-1|AAF60850.2|  347|Caenorhabditis elegans Hypothetical
           protein Y65B4BL.3 protein.
          Length = 347

 Score = 28.7 bits (61), Expect = 4.4
 Identities = 17/49 (34%), Positives = 27/49 (55%)
 Frame = +3

Query: 3   HEXFTCLSKTCLFVNNLKSNLPTDIFIKGLQYFDCTKVA*SLVF*LVTC 149
           +E F C S TC +++ +  NLP    I G ++F   K A  L+F  ++C
Sbjct: 66  NESFRCSSSTCYWLHRIVLNLPR-FMISG-EFF-VEKCAYLLIFFFISC 111


  Database: celegans
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 12,740,198
  Number of sequences in database:  27,780
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 11,030,397
Number of Sequences: 27780
Number of extensions: 175979
Number of successful extensions: 220
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 218
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 220
length of database: 12,740,198
effective HSP length: 79
effective length of database: 10,545,578
effective search space used: 1697838058
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)