BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= brP-0180 (550 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AJ535204-1|CAD59404.1| 1187|Anopheles gambiae SMC2 protein protein. 23 5.0 AJ237706-1|CAB40347.1| 570|Anopheles gambiae putative 5'-nucleo... 23 5.0 U29486-1|AAC46995.1| 695|Anopheles gambiae ATP-binding-cassette... 23 6.6 U29485-1|AAC46994.1| 695|Anopheles gambiae ATP-binding-cassette... 23 6.6 U29484-1|AAC47423.1| 673|Anopheles gambiae ATP-binding-cassette... 23 6.6 >AJ535204-1|CAD59404.1| 1187|Anopheles gambiae SMC2 protein protein. Length = 1187 Score = 23.4 bits (48), Expect = 5.0 Identities = 12/33 (36%), Positives = 19/33 (57%), Gaps = 1/33 (3%) Frame = -3 Query: 368 RYLXRGRSIVQNVVRNLYCR-QRNIIQLNRLSM 273 +YL G+S+ V++L+C Q N+ N L M Sbjct: 114 KYLINGKSVQNKRVQDLFCSVQLNVNNPNFLIM 146 >AJ237706-1|CAB40347.1| 570|Anopheles gambiae putative 5'-nucleotidase protein. Length = 570 Score = 23.4 bits (48), Expect = 5.0 Identities = 11/30 (36%), Positives = 17/30 (56%) Frame = +3 Query: 327 DNILYNTAPPXQIPLPADITQAPXGXVKSI 416 D YNTA + + AD+++ P V+SI Sbjct: 447 DEFRYNTAQVSGMTVVADLSKKPYERVQSI 476 >U29486-1|AAC46995.1| 695|Anopheles gambiae ATP-binding-cassette protein protein. Length = 695 Score = 23.0 bits (47), Expect = 6.6 Identities = 9/35 (25%), Positives = 19/35 (54%) Frame = +3 Query: 285 VQLDDIXLPAIQVPDNILYNTAPPXQIPLPADITQ 389 VQ DD+ +P++ +++L+ +PA + Q Sbjct: 181 VQQDDLFIPSLTTREHLLFQAMLRMGRDVPASVKQ 215 >U29485-1|AAC46994.1| 695|Anopheles gambiae ATP-binding-cassette protein protein. Length = 695 Score = 23.0 bits (47), Expect = 6.6 Identities = 9/35 (25%), Positives = 19/35 (54%) Frame = +3 Query: 285 VQLDDIXLPAIQVPDNILYNTAPPXQIPLPADITQ 389 VQ DD+ +P++ +++L+ +PA + Q Sbjct: 181 VQQDDLFIPSLTTREHLLFQAMLRMGRDVPASVKQ 215 >U29484-1|AAC47423.1| 673|Anopheles gambiae ATP-binding-cassette protein protein. Length = 673 Score = 23.0 bits (47), Expect = 6.6 Identities = 9/35 (25%), Positives = 19/35 (54%) Frame = +3 Query: 285 VQLDDIXLPAIQVPDNILYNTAPPXQIPLPADITQ 389 VQ DD+ +P++ +++L+ +PA + Q Sbjct: 159 VQQDDLFIPSLTTREHLLFQAMLRMGRDVPASVKQ 193 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 438,666 Number of Sequences: 2352 Number of extensions: 7381 Number of successful extensions: 16 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 16 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 16 length of database: 563,979 effective HSP length: 61 effective length of database: 420,507 effective search space used: 50881347 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -