BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= brP-0180 (550 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At3g54260.1 68416.m05997 expressed protein various predicted pro... 27 6.2 At5g20730.3 68418.m02464 auxin-responsive factor (ARF7) identica... 27 8.3 At5g20730.2 68418.m02463 auxin-responsive factor (ARF7) identica... 27 8.3 At5g20730.1 68418.m02462 auxin-responsive factor (ARF7) identica... 27 8.3 >At3g54260.1 68416.m05997 expressed protein various predicted proteins, Arabidopsis thaliana Length = 379 Score = 27.5 bits (58), Expect = 6.2 Identities = 11/41 (26%), Positives = 25/41 (60%) Frame = -3 Query: 389 LGNIRGQRYLXRGRSIVQNVVRNLYCRQRNIIQLNRLSMLH 267 LG +RG+R + G S+++N +L C ++++ +R + + Sbjct: 111 LGKMRGKRIMLVGDSMMRNQWESLVCLVQSVLPTHRKKLTY 151 >At5g20730.3 68418.m02464 auxin-responsive factor (ARF7) identical to auxin response factor 7 GI:4104929 from [Arabidopsis thaliana] Length = 1150 Score = 27.1 bits (57), Expect = 8.3 Identities = 13/28 (46%), Positives = 15/28 (53%) Frame = +3 Query: 261 ESVKHAQSVQLDDIXLPAIQVPDNILYN 344 +S H Q QL L +QVP N LYN Sbjct: 590 QSHSHPQPQQLQQHKLQQLQVPQNQLYN 617 >At5g20730.2 68418.m02463 auxin-responsive factor (ARF7) identical to auxin response factor 7 GI:4104929 from [Arabidopsis thaliana] Length = 1164 Score = 27.1 bits (57), Expect = 8.3 Identities = 13/28 (46%), Positives = 15/28 (53%) Frame = +3 Query: 261 ESVKHAQSVQLDDIXLPAIQVPDNILYN 344 +S H Q QL L +QVP N LYN Sbjct: 589 QSHSHPQPQQLQQHKLQQLQVPQNQLYN 616 >At5g20730.1 68418.m02462 auxin-responsive factor (ARF7) identical to auxin response factor 7 GI:4104929 from [Arabidopsis thaliana] Length = 1165 Score = 27.1 bits (57), Expect = 8.3 Identities = 13/28 (46%), Positives = 15/28 (53%) Frame = +3 Query: 261 ESVKHAQSVQLDDIXLPAIQVPDNILYN 344 +S H Q QL L +QVP N LYN Sbjct: 590 QSHSHPQPQQLQQHKLQQLQVPQNQLYN 617 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 8,793,466 Number of Sequences: 28952 Number of extensions: 150698 Number of successful extensions: 309 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 304 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 309 length of database: 12,070,560 effective HSP length: 77 effective length of database: 9,841,256 effective search space used: 1033331880 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -