BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= brP-0177 (773 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AB090812-1|BAC57899.1| 541|Anopheles gambiae gag-like protein p... 25 2.6 X85217-1|CAA59483.1| 1231|Anopheles gambiae Anlar protein. 24 4.5 >AB090812-1|BAC57899.1| 541|Anopheles gambiae gag-like protein protein. Length = 541 Score = 25.0 bits (52), Expect = 2.6 Identities = 11/29 (37%), Positives = 16/29 (55%) Frame = +2 Query: 467 PIVIXRHAHGDQYXAQDFVVPKPGKVELV 553 P + + AH Q Q V P+P K+E+V Sbjct: 290 PPQLRQQAHQQQQRQQQKVRPRPDKIEVV 318 >X85217-1|CAA59483.1| 1231|Anopheles gambiae Anlar protein. Length = 1231 Score = 24.2 bits (50), Expect = 4.5 Identities = 10/32 (31%), Positives = 18/32 (56%) Frame = +2 Query: 62 ASLTRNYGTAKRVVAAKPVVEMDGDEMTRIMW 157 ASL Y KR +AA+ ++ ++ R++W Sbjct: 1021 ASLVDGYRYRKRYIAAQGPLQETAEDFWRMLW 1052 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 798,183 Number of Sequences: 2352 Number of extensions: 16118 Number of successful extensions: 59 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 58 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 59 length of database: 563,979 effective HSP length: 63 effective length of database: 415,803 effective search space used: 80665782 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -