BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= brP-0177 (773 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AB193550-1|BAD66824.1| 699|Apis mellifera soluble guanylyl cycl... 27 0.26 DQ435329-1|ABD92644.1| 150|Apis mellifera OBP12 protein. 25 1.0 >AB193550-1|BAD66824.1| 699|Apis mellifera soluble guanylyl cyclase alpha 1 subunit protein. Length = 699 Score = 26.6 bits (56), Expect = 0.26 Identities = 14/58 (24%), Positives = 27/58 (46%) Frame = +2 Query: 476 IXRHAHGDQYXAQDFVVPKPGKVELVYTTRDGTTEXRVLYDFKTPGVAMGMYNTDESI 649 + +H G + A+ + P +EL +TT + ++ K G+A YN D ++ Sbjct: 180 VVQHQSGSEAEAEFVCIATPEAIELHFTTDHPSVAYLLVGSLK--GIARQFYNDDANV 235 >DQ435329-1|ABD92644.1| 150|Apis mellifera OBP12 protein. Length = 150 Score = 24.6 bits (51), Expect = 1.0 Identities = 9/32 (28%), Positives = 15/32 (46%) Frame = +2 Query: 569 GTTEXRVLYDFKTPGVAMGMYNTDESIRSFXH 664 G L + G+ G Y+ DE +++F H Sbjct: 80 GVMNGSELSTYNIAGIIEGQYHDDEDLKTFFH 111 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 214,000 Number of Sequences: 438 Number of extensions: 4546 Number of successful extensions: 2 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 2 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2 length of database: 146,343 effective HSP length: 57 effective length of database: 121,377 effective search space used: 24275400 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -