BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= brP-0174 (776 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPBC1198.08 |||dipeptidase Dug1 |Schizosaccharomyces pombe|chr 2... 26 5.2 SPBP8B7.30c |thi5||transcription factor Thi5|Schizosaccharomyces... 25 9.2 >SPBC1198.08 |||dipeptidase Dug1 |Schizosaccharomyces pombe|chr 2|||Manual Length = 474 Score = 26.2 bits (55), Expect = 5.2 Identities = 11/29 (37%), Positives = 19/29 (65%) Frame = +2 Query: 251 KALGVDFILIVIICVNVSPKYGSDTLINL 337 K LG+DF + +++C +YGS+ L +L Sbjct: 147 KELGIDFPVNLLMCFEGMEEYGSEGLEDL 175 >SPBP8B7.30c |thi5||transcription factor Thi5|Schizosaccharomyces pombe|chr 2|||Manual Length = 857 Score = 25.4 bits (53), Expect = 9.2 Identities = 10/35 (28%), Positives = 19/35 (54%) Frame = -2 Query: 577 VFDVSSIKSYTFNXNLTYSYELSNESPHQNPRLSW 473 +FD++S N L+ S+E N+ Q+ ++W Sbjct: 748 IFDINSATEMPINEPLSASFESVNKENSQSGYMAW 782 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,827,796 Number of Sequences: 5004 Number of extensions: 53943 Number of successful extensions: 119 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 118 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 119 length of database: 2,362,478 effective HSP length: 71 effective length of database: 2,007,194 effective search space used: 375345278 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -