BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= brP-0174 (776 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 09_04_0662 + 19296395-19296532,19296650-19296742,19296976-192971... 30 1.8 02_04_0347 + 22193708-22193720,22194317-22194390,22195388-221961... 28 9.5 >09_04_0662 + 19296395-19296532,19296650-19296742,19296976-19297128, 19297213-19297596 Length = 255 Score = 30.3 bits (65), Expect = 1.8 Identities = 12/27 (44%), Positives = 20/27 (74%) Frame = -1 Query: 731 NISMRNTSRLHCINCLAYVNDGKSFEC 651 N+ +RN +RLH INCL+++ + F+C Sbjct: 33 NLDLRNLTRLHLINCLSHL---EVFDC 56 >02_04_0347 + 22193708-22193720,22194317-22194390,22195388-22196132, 22196203-22196417,22196505-22196786,22196870-22196998, 22197088-22197267,22197538-22197645,22197888-22198094 Length = 650 Score = 27.9 bits (59), Expect = 9.5 Identities = 11/31 (35%), Positives = 15/31 (48%) Frame = -2 Query: 565 SSIKSYTFNXNLTYSYELSNESPHQNPRLSW 473 SS+K + L Y S+ PH+NP W Sbjct: 511 SSVKQLNVSHGLLYGRINSDSGPHRNPESKW 541 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 16,585,112 Number of Sequences: 37544 Number of extensions: 285321 Number of successful extensions: 401 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 397 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 401 length of database: 14,793,348 effective HSP length: 81 effective length of database: 11,752,284 effective search space used: 2080154268 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -