BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= brP-0174 (776 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AY350617-1|AAQ57659.1| 428|Apis mellifera complementary sex det... 24 1.8 AB161182-1|BAD08344.1| 1040|Apis mellifera metabotropic glutamat... 22 7.3 DQ325080-1|ABD14094.1| 184|Apis mellifera complementary sex det... 21 9.7 DQ325079-1|ABD14093.1| 184|Apis mellifera complementary sex det... 21 9.7 DQ325078-1|ABD14092.1| 184|Apis mellifera complementary sex det... 21 9.7 >AY350617-1|AAQ57659.1| 428|Apis mellifera complementary sex determiner protein. Length = 428 Score = 23.8 bits (49), Expect = 1.8 Identities = 13/35 (37%), Positives = 18/35 (51%) Frame = -2 Query: 514 LSNESPHQNPRLSWNRTHNNETV*KYCA*INYNNH 410 LSN++ H N +N +NN Y NYNN+ Sbjct: 318 LSNKTIHNNNNYKYNYNNNNYNNNNYNN--NYNNN 350 >AB161182-1|BAD08344.1| 1040|Apis mellifera metabotropic glutamate receptor protein. Length = 1040 Score = 21.8 bits (44), Expect = 7.3 Identities = 14/63 (22%), Positives = 35/63 (55%) Frame = +3 Query: 528 VRLXLNV*DLILDTSKTLYHSQYFKNTSVVKHFQLAHNSALAFK*LSVIYIS*TVYAM*S 707 V++ +N +I+D +K ++H ++ +V + + + +AF ++ + TVYA+ + Sbjct: 778 VQILINGVWMIIDPAKAMHHYPTREDNLLVCNSYVDASYMIAFAYPIMLIVVCTVYAVLT 837 Query: 708 GRI 716 +I Sbjct: 838 RKI 840 >DQ325080-1|ABD14094.1| 184|Apis mellifera complementary sex determiner protein. Length = 184 Score = 21.4 bits (43), Expect = 9.7 Identities = 8/20 (40%), Positives = 12/20 (60%) Frame = -2 Query: 514 LSNESPHQNPRLSWNRTHNN 455 LSN++ H N +N +NN Sbjct: 85 LSNKTIHNNNNYKYNYNNNN 104 >DQ325079-1|ABD14093.1| 184|Apis mellifera complementary sex determiner protein. Length = 184 Score = 21.4 bits (43), Expect = 9.7 Identities = 8/20 (40%), Positives = 12/20 (60%) Frame = -2 Query: 514 LSNESPHQNPRLSWNRTHNN 455 LSN++ H N +N +NN Sbjct: 85 LSNKTIHNNNNYKYNYNNNN 104 >DQ325078-1|ABD14092.1| 184|Apis mellifera complementary sex determiner protein. Length = 184 Score = 21.4 bits (43), Expect = 9.7 Identities = 8/20 (40%), Positives = 12/20 (60%) Frame = -2 Query: 514 LSNESPHQNPRLSWNRTHNN 455 LSN++ H N +N +NN Sbjct: 85 LSNKTIHNNNNYKYNYNNNN 104 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 190,723 Number of Sequences: 438 Number of extensions: 3688 Number of successful extensions: 8 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 8 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 8 length of database: 146,343 effective HSP length: 57 effective length of database: 121,377 effective search space used: 24396777 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -