BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= brP-0173 (504 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AB072429-1|BAB83990.1| 388|Apis mellifera IP3phosphatase protein. 23 1.4 AF469010-1|AAL93136.1| 678|Apis mellifera cGMP-dependent protei... 22 3.2 AY769960-1|AAV34676.1| 603|Apis mellifera soluble guanylyl cycl... 22 4.2 AB181489-1|BAD22772.1| 603|Apis mellifera soluble guanylyl cycl... 22 4.2 DQ468657-1|ABE02558.1| 322|Apis mellifera 1,4,5-trisphosphate r... 21 5.5 AB006152-1|BAA24504.1| 178|Apis mellifera inositol 1,4,5-tripho... 21 5.5 AB267886-1|BAF46356.1| 567|Apis mellifera ecdysteroid receptor ... 21 7.3 AY336529-1|AAQ02340.1| 712|Apis mellifera transferrin protein. 21 9.6 AY336528-1|AAQ02339.1| 712|Apis mellifera transferrin protein. 21 9.6 AY217097-1|AAO39761.1| 712|Apis mellifera transferrin protein. 21 9.6 AF388659-3|AAK71993.1| 548|Apis mellifera 1D-myo-inositol-trisp... 21 9.6 AF388659-2|AAK71994.1| 463|Apis mellifera 1D-myo-inositol-trisp... 21 9.6 AF388659-1|AAK71995.1| 782|Apis mellifera 1D-myo-inositol-trisp... 21 9.6 >AB072429-1|BAB83990.1| 388|Apis mellifera IP3phosphatase protein. Length = 388 Score = 23.4 bits (48), Expect = 1.4 Identities = 8/28 (28%), Positives = 14/28 (50%) Frame = +2 Query: 275 PHAPFRQEFDESNEWSGKPIPGWLYRPL 358 P PF ++ +E + + +P W R L Sbjct: 318 PSYPFEEDINEGSNYMQTRVPAWCDRVL 345 >AF469010-1|AAL93136.1| 678|Apis mellifera cGMP-dependent protein kinase foraging protein. Length = 678 Score = 22.2 bits (45), Expect = 3.2 Identities = 8/18 (44%), Positives = 11/18 (61%) Frame = +3 Query: 207 RTATPPSIPSTKTVTDTS 260 RT PP +P + TDT+ Sbjct: 637 RTLEPPIMPRVQNATDTT 654 >AY769960-1|AAV34676.1| 603|Apis mellifera soluble guanylyl cyclase beta 1 subunit protein. Length = 603 Score = 21.8 bits (44), Expect = 4.2 Identities = 13/56 (23%), Positives = 25/56 (44%) Frame = +2 Query: 170 GRNADVTALKLPSHGYPTEHPFNKDGYRYILAEPDPHAPFRQEFDESNEWSGKPIP 337 G ++T+ + + G P + ++D YRY+ + + F E+ GK P Sbjct: 535 GNTVNLTS-RTETTGEPGKINVSEDAYRYLCMPENQDSQFLLEYRGPVTMKGKSEP 589 >AB181489-1|BAD22772.1| 603|Apis mellifera soluble guanylyl cyclase beta 1 subunit protein. Length = 603 Score = 21.8 bits (44), Expect = 4.2 Identities = 13/56 (23%), Positives = 25/56 (44%) Frame = +2 Query: 170 GRNADVTALKLPSHGYPTEHPFNKDGYRYILAEPDPHAPFRQEFDESNEWSGKPIP 337 G ++T+ + + G P + ++D YRY+ + + F E+ GK P Sbjct: 535 GNTVNLTS-RTETTGEPGKINVSEDAYRYLCMPENQDSQFLLEYRGPVTMKGKSEP 589 >DQ468657-1|ABE02558.1| 322|Apis mellifera 1,4,5-trisphosphate receptor protein. Length = 322 Score = 21.4 bits (43), Expect = 5.5 Identities = 8/13 (61%), Positives = 10/13 (76%) Frame = +2 Query: 287 FRQEFDESNEWSG 325 F+QEFDE+ SG Sbjct: 74 FKQEFDETERASG 86 >AB006152-1|BAA24504.1| 178|Apis mellifera inositol 1,4,5-triphosphate recepter protein. Length = 178 Score = 21.4 bits (43), Expect = 5.5 Identities = 8/13 (61%), Positives = 10/13 (76%) Frame = +2 Query: 287 FRQEFDESNEWSG 325 F+QEFDE+ SG Sbjct: 42 FKQEFDETERASG 54 >AB267886-1|BAF46356.1| 567|Apis mellifera ecdysteroid receptor A isoform protein. Length = 567 Score = 21.0 bits (42), Expect = 7.3 Identities = 8/17 (47%), Positives = 10/17 (58%) Frame = +3 Query: 210 TATPPSIPSTKTVTDTS 260 T TPPS+P V T+ Sbjct: 51 TPTPPSVPVGSAVAGTA 67 >AY336529-1|AAQ02340.1| 712|Apis mellifera transferrin protein. Length = 712 Score = 20.6 bits (41), Expect = 9.6 Identities = 6/14 (42%), Positives = 10/14 (71%) Frame = +2 Query: 257 ILAEPDPHAPFRQE 298 + + +PHAP+R E Sbjct: 111 VRTKEEPHAPYRYE 124 >AY336528-1|AAQ02339.1| 712|Apis mellifera transferrin protein. Length = 712 Score = 20.6 bits (41), Expect = 9.6 Identities = 6/14 (42%), Positives = 10/14 (71%) Frame = +2 Query: 257 ILAEPDPHAPFRQE 298 + + +PHAP+R E Sbjct: 111 VRTKEEPHAPYRYE 124 >AY217097-1|AAO39761.1| 712|Apis mellifera transferrin protein. Length = 712 Score = 20.6 bits (41), Expect = 9.6 Identities = 6/14 (42%), Positives = 10/14 (71%) Frame = +2 Query: 257 ILAEPDPHAPFRQE 298 + + +PHAP+R E Sbjct: 111 VRTKEEPHAPYRYE 124 >AF388659-3|AAK71993.1| 548|Apis mellifera 1D-myo-inositol-trisphosphate 3-kinaseisoform C protein. Length = 548 Score = 20.6 bits (41), Expect = 9.6 Identities = 8/27 (29%), Positives = 12/27 (44%) Frame = +2 Query: 284 PFRQEFDESNEWSGKPIPGWLYRPLCP 364 P+ Q + P PG + + LCP Sbjct: 241 PWVQLAGHQGNFRAGPTPGTILKKLCP 267 >AF388659-2|AAK71994.1| 463|Apis mellifera 1D-myo-inositol-trisphosphate 3-kinaseisoform B protein. Length = 463 Score = 20.6 bits (41), Expect = 9.6 Identities = 8/27 (29%), Positives = 12/27 (44%) Frame = +2 Query: 284 PFRQEFDESNEWSGKPIPGWLYRPLCP 364 P+ Q + P PG + + LCP Sbjct: 156 PWVQLAGHQGNFRAGPTPGTILKKLCP 182 >AF388659-1|AAK71995.1| 782|Apis mellifera 1D-myo-inositol-trisphosphate 3-kinaseisoform A protein. Length = 782 Score = 20.6 bits (41), Expect = 9.6 Identities = 8/27 (29%), Positives = 12/27 (44%) Frame = +2 Query: 284 PFRQEFDESNEWSGKPIPGWLYRPLCP 364 P+ Q + P PG + + LCP Sbjct: 475 PWVQLAGHQGNFRAGPTPGTILKKLCP 501 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 112,716 Number of Sequences: 438 Number of extensions: 2226 Number of successful extensions: 13 Number of sequences better than 10.0: 13 Number of HSP's better than 10.0 without gapping: 13 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 13 length of database: 146,343 effective HSP length: 54 effective length of database: 122,691 effective search space used: 13864083 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -