BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= brP-0170 (795 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AF230521-1|AAF36974.2| 185|Anopheles gambiae homeobox transcrip... 25 2.7 AJ010193-1|CAA09032.1| 684|Anopheles gambiae prophenoloxidase p... 25 3.6 AY341224-1|AAR13788.1| 287|Anopheles gambiae TOLL9 protein. 24 6.2 AY341223-1|AAR13787.1| 287|Anopheles gambiae TOLL9 protein. 24 6.2 AY341222-1|AAR13786.1| 287|Anopheles gambiae TOLL9 protein. 24 6.2 AY341221-1|AAR13785.1| 287|Anopheles gambiae TOLL9 protein. 24 6.2 AY341220-1|AAR13784.1| 287|Anopheles gambiae TOLL9 protein. 24 6.2 AF444782-1|AAL37903.1| 576|Anopheles gambiae Toll9 protein. 24 6.2 >AF230521-1|AAF36974.2| 185|Anopheles gambiae homeobox transcription factor protein. Length = 185 Score = 25.0 bits (52), Expect = 2.7 Identities = 8/19 (42%), Positives = 12/19 (63%) Frame = +1 Query: 199 SHRPQYNLESFENYSSENF 255 SH Y ++++ NYS NF Sbjct: 137 SHNQYYYMQNYSNYSQHNF 155 >AJ010193-1|CAA09032.1| 684|Anopheles gambiae prophenoloxidase protein. Length = 684 Score = 24.6 bits (51), Expect = 3.6 Identities = 16/44 (36%), Positives = 19/44 (43%), Gaps = 2/44 (4%) Frame = +3 Query: 513 VRKNEYHHRSDAADS--TXHCQPYPASNQTGQGNQXSXAIPSPN 638 V KN D DS T H +P+ A+ Q G IP PN Sbjct: 21 VPKNNGQLYFDVPDSYLTDHYRPFGAALQNRFGTNAQTRIPLPN 64 >AY341224-1|AAR13788.1| 287|Anopheles gambiae TOLL9 protein. Length = 287 Score = 23.8 bits (49), Expect = 6.2 Identities = 10/20 (50%), Positives = 14/20 (70%), Gaps = 1/20 (5%) Frame = -2 Query: 185 VGFCILTGAGV-WYWDYLCY 129 V F ILTG G+ +YW ++ Y Sbjct: 153 VSFLILTGVGLFYYWFHIKY 172 >AY341223-1|AAR13787.1| 287|Anopheles gambiae TOLL9 protein. Length = 287 Score = 23.8 bits (49), Expect = 6.2 Identities = 10/20 (50%), Positives = 14/20 (70%), Gaps = 1/20 (5%) Frame = -2 Query: 185 VGFCILTGAGV-WYWDYLCY 129 V F ILTG G+ +YW ++ Y Sbjct: 153 VSFLILTGVGLFYYWFHIKY 172 >AY341222-1|AAR13786.1| 287|Anopheles gambiae TOLL9 protein. Length = 287 Score = 23.8 bits (49), Expect = 6.2 Identities = 10/20 (50%), Positives = 14/20 (70%), Gaps = 1/20 (5%) Frame = -2 Query: 185 VGFCILTGAGV-WYWDYLCY 129 V F ILTG G+ +YW ++ Y Sbjct: 153 VSFLILTGVGLFYYWFHIKY 172 >AY341221-1|AAR13785.1| 287|Anopheles gambiae TOLL9 protein. Length = 287 Score = 23.8 bits (49), Expect = 6.2 Identities = 10/20 (50%), Positives = 14/20 (70%), Gaps = 1/20 (5%) Frame = -2 Query: 185 VGFCILTGAGV-WYWDYLCY 129 V F ILTG G+ +YW ++ Y Sbjct: 153 VSFLILTGVGLFYYWFHIKY 172 >AY341220-1|AAR13784.1| 287|Anopheles gambiae TOLL9 protein. Length = 287 Score = 23.8 bits (49), Expect = 6.2 Identities = 10/20 (50%), Positives = 14/20 (70%), Gaps = 1/20 (5%) Frame = -2 Query: 185 VGFCILTGAGV-WYWDYLCY 129 V F ILTG G+ +YW ++ Y Sbjct: 153 VSFLILTGVGLFYYWFHIKY 172 >AF444782-1|AAL37903.1| 576|Anopheles gambiae Toll9 protein. Length = 576 Score = 23.8 bits (49), Expect = 6.2 Identities = 10/20 (50%), Positives = 14/20 (70%), Gaps = 1/20 (5%) Frame = -2 Query: 185 VGFCILTGAGV-WYWDYLCY 129 V F ILTG G+ +YW ++ Y Sbjct: 380 VSFLILTGVGLFYYWFHIKY 399 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 782,069 Number of Sequences: 2352 Number of extensions: 15603 Number of successful extensions: 30 Number of sequences better than 10.0: 8 Number of HSP's better than 10.0 without gapping: 30 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 30 length of database: 563,979 effective HSP length: 63 effective length of database: 415,803 effective search space used: 83576403 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -