BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= brP-0166 (775 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_7992| Best HMM Match : No HMM Matches (HMM E-Value=.) 96 3e-20 SB_11691| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.4 SB_18756| Best HMM Match : Sterol_desat (HMM E-Value=0) 29 4.2 SB_4559| Best HMM Match : ICAM_N (HMM E-Value=5.3) 29 4.2 SB_29194| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 5.5 SB_4318| Best HMM Match : Ligase_CoA (HMM E-Value=0) 29 5.5 SB_26920| Best HMM Match : Rap_GAP (HMM E-Value=6.9e-29) 28 7.3 SB_46179| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 9.6 SB_51664| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 9.6 >SB_7992| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 298 Score = 95.9 bits (228), Expect = 3e-20 Identities = 58/184 (31%), Positives = 86/184 (46%), Gaps = 3/184 (1%) Frame = +2 Query: 110 FRIFLYNSETGQVLGRTGSSWAKXXXXXXXXXXXXVGFFAALLAVFYQTLDTKVPKWQLD 289 F+ FLYN E G+V+GR G SWAK GFFAA+L++F TL + +L Sbjct: 24 FKTFLYNKEKGEVMGRNGQSWAKIGLFFLVFYLCLAGFFAAMLSIFLSTLPDRADGPKLT 83 Query: 290 SSIIGSNPGLGFRPMPDTANVESTLIYYKVNDKGSVLKWAXVIDEFLNQYRKKGSGSGEA 469 I G P L P+P +E Y N S I+ FLNQY ++G + + Sbjct: 84 QYIAG-KPVL--NPVPSN-KIEG----YDPNKASSYSSHVSDINSFLNQYVRQGGANKDQ 135 Query: 470 HGAENRVPCSPSSGPLGEKQVCDVPVDDFNPC---TPANQYNYEQAGPCVFLKLNKIYNW 640 + S P K+ C + + PC +Y ++ PC FL++NK++N+ Sbjct: 136 FAPDFCNGTSGEPRPKDAKKQCRFDLTNLGPCYKNETGFKYGFDTGSPCFFLRMNKVFNF 195 Query: 641 XPQP 652 P+P Sbjct: 196 VPEP 199 >SB_11691| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1448 Score = 30.7 bits (66), Expect = 1.4 Identities = 18/58 (31%), Positives = 30/58 (51%) Frame = +2 Query: 332 MPDTANVESTLIYYKVNDKGSVLKWAXVIDEFLNQYRKKGSGSGEAHGAENRVPCSPS 505 +PD + ST +V +KG+++K A +ID +R + G H + VP SP+ Sbjct: 330 IPDFKDCSSTNQTERVEEKGALIKKA-MIDSSREDFRDQAHGEHVTHPIKWLVPSSPT 386 >SB_18756| Best HMM Match : Sterol_desat (HMM E-Value=0) Length = 672 Score = 29.1 bits (62), Expect = 4.2 Identities = 13/44 (29%), Positives = 24/44 (54%), Gaps = 1/44 (2%) Frame = -2 Query: 159 VRPRTWPVSELYRKILNASHFXRSGGGA*YCS-ATLFLSAMFTR 31 + P++WP +++YR++L+ GG Y AT A+F + Sbjct: 405 IYPKSWPENDIYRQVLSILLMVNVGGALLYLGLATFSYYAIFDK 448 >SB_4559| Best HMM Match : ICAM_N (HMM E-Value=5.3) Length = 244 Score = 29.1 bits (62), Expect = 4.2 Identities = 20/78 (25%), Positives = 31/78 (39%) Frame = +2 Query: 305 SNPGLGFRPMPDTANVESTLIYYKVNDKGSVLKWAXVIDEFLNQYRKKGSGSGEAHGAEN 484 + P G R A E L YY D+G ++ L++Y S +HG + Sbjct: 34 NRPTRGERRFAYWALAECILAYYVGTDEGVSEVLHVAGEKRLHRYYYTSSNDSHSHGETD 93 Query: 485 RVPCSPSSGPLGEKQVCD 538 S LGE+ +C+ Sbjct: 94 SNSSGQSDVSLGEEAICN 111 >SB_29194| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2916 Score = 28.7 bits (61), Expect = 5.5 Identities = 14/31 (45%), Positives = 19/31 (61%) Frame = -3 Query: 173 PSLSLCARGPGPSPSCTGRS*TPPISXGPVA 81 P+ + A G GP PS TG++ P +S PVA Sbjct: 2311 PTTTSVAMGAGPPPSATGQA-LPVMSPAPVA 2340 >SB_4318| Best HMM Match : Ligase_CoA (HMM E-Value=0) Length = 229 Score = 28.7 bits (61), Expect = 5.5 Identities = 16/33 (48%), Positives = 21/33 (63%), Gaps = 3/33 (9%) Frame = +1 Query: 157 HRLKL-GKDPAILPYLLRDFGGLLRCS--ASGI 246 H LK+ KDP + L+ FGG++ CS ASGI Sbjct: 142 HALKIVSKDPRVKVILVNIFGGIVDCSVVASGI 174 >SB_26920| Best HMM Match : Rap_GAP (HMM E-Value=6.9e-29) Length = 1890 Score = 28.3 bits (60), Expect = 7.3 Identities = 11/22 (50%), Positives = 14/22 (63%) Frame = -2 Query: 570 GVQGLKSSTGTSQTCFSPSGPL 505 G +G SS GT Q +SP GP+ Sbjct: 479 GTRGRTSSVGTGQQSYSPQGPV 500 >SB_46179| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 4856 Score = 27.9 bits (59), Expect = 9.6 Identities = 12/36 (33%), Positives = 20/36 (55%) Frame = +2 Query: 434 QYRKKGSGSGEAHGAENRVPCSPSSGPLGEKQVCDV 541 +Y GS S E ++ +PC P+GE+++ DV Sbjct: 1636 KYNMAGSVSHEPAAHDSVMPCKIGVKPMGEREMSDV 1671 >SB_51664| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 183 Score = 27.9 bits (59), Expect = 9.6 Identities = 13/47 (27%), Positives = 21/47 (44%) Frame = -3 Query: 611 RRKGRLVRNCTGWLECRD*SHRLVHHRLASRRVVRCWESMVRGFRHH 471 + +GR +RNCT C R H+ + +E++ G HH Sbjct: 34 KTRGRNIRNCTSGTLCCRVGRRAARHQAIAPLYTCRYEAVWAGLDHH 80 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 24,977,484 Number of Sequences: 59808 Number of extensions: 547939 Number of successful extensions: 1541 Number of sequences better than 10.0: 9 Number of HSP's better than 10.0 without gapping: 1309 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1537 length of database: 16,821,457 effective HSP length: 81 effective length of database: 11,977,009 effective search space used: 2107953584 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -