BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= brP-0162 (703 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AB231585-1|BAE17127.1| 898|Apis mellifera Mahya protein. 29 0.043 AB253415-1|BAE86926.1| 588|Apis mellifera alpha-glucosidase pro... 22 4.9 AF205594-1|AAQ13840.1| 156|Apis mellifera acid phosphatase prec... 22 6.5 >AB231585-1|BAE17127.1| 898|Apis mellifera Mahya protein. Length = 898 Score = 29.1 bits (62), Expect = 0.043 Identities = 19/55 (34%), Positives = 27/55 (49%) Frame = +3 Query: 456 SDTIENVKAKIQDKEGIPPDQQRLIFAGKQLGRRTHLVRLQYSKGIYTPFSVTST 620 +DT+ K KI K I PD + L+ KQ T +V+ S G+ F V +T Sbjct: 732 TDTVLAYKPKILGKPTISPDSRHLVTLDKQETGVTLVVQEISSDGLKFAFDVKTT 786 Score = 26.6 bits (56), Expect = 0.23 Identities = 16/37 (43%), Positives = 20/37 (54%) Frame = +3 Query: 228 SDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL 338 +DT+ K KI K I PD + L+ KQ E G TL Sbjct: 732 TDTVLAYKPKILGKPTISPDSRHLVTLDKQ-ETGVTL 767 >AB253415-1|BAE86926.1| 588|Apis mellifera alpha-glucosidase protein. Length = 588 Score = 22.2 bits (45), Expect = 4.9 Identities = 8/33 (24%), Positives = 19/33 (57%) Frame = +2 Query: 116 IIVRHTTDKAKLLYLLDHHANLCEDSNWQDHYI 214 ++ HT+D+ K + ++ N + ++D+YI Sbjct: 118 LVPNHTSDQHKWFQMSINNTNNNNTNKYKDYYI 150 >AF205594-1|AAQ13840.1| 156|Apis mellifera acid phosphatase precursor protein. Length = 156 Score = 21.8 bits (44), Expect = 6.5 Identities = 10/20 (50%), Positives = 12/20 (60%) Frame = -3 Query: 293 LLIRRNSFFVLDLRLHILNC 234 LLIR SF +L+ L NC Sbjct: 137 LLIRFKSFSLLNFNLLFFNC 156 Score = 21.4 bits (43), Expect = 8.6 Identities = 10/20 (50%), Positives = 12/20 (60%) Frame = -3 Query: 521 LLIRRNSFFVLDLRLHVLNC 462 LLIR SF +L+ L NC Sbjct: 137 LLIRFKSFSLLNFNLLFFNC 156 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 184,483 Number of Sequences: 438 Number of extensions: 3868 Number of successful extensions: 7 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 5 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 7 length of database: 146,343 effective HSP length: 56 effective length of database: 121,815 effective search space used: 21561255 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -