BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= brP-0161 (419 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 03_06_0379 + 33505242-33505347,33505474-33505631,33506127-335061... 60 7e-10 07_01_0744 + 5687269-5687365,5687466-5687689,5688307-5688354,568... 48 3e-06 08_01_0907 + 8949102-8949160,8949662-8949842,8951816-8951941,895... 39 0.002 06_03_0540 - 21923763-21923945,21924027-21924776,21924895-219253... 33 0.12 11_06_0649 + 25882657-25882782,25882983-25883175,25883354-25884120 29 2.0 03_06_0102 + 31656268-31656304,31656625-31656920,31657967-31658080 28 3.5 05_06_0025 + 25018426-25018596,25018692-25018892,25018983-250192... 27 4.6 11_01_0771 + 6453130-6454488 27 6.1 08_02_1154 - 24727668-24728275,24728503-24728844,24730216-24731119 27 6.1 10_08_0672 + 19762340-19762432,19762543-19762735,19763225-197632... 27 8.1 07_03_1525 + 27448257-27448582,27450741-27450973,27451280-274529... 27 8.1 03_04_0140 + 17638335-17638583,17638843-17639061,17639206-176394... 27 8.1 >03_06_0379 + 33505242-33505347,33505474-33505631,33506127-33506174, 33506851-33506919 Length = 126 Score = 60.1 bits (139), Expect = 7e-10 Identities = 36/86 (41%), Positives = 51/86 (59%), Gaps = 3/86 (3%) Frame = +3 Query: 84 SGFNKYGLLRDDCL---HETPDVTEALRRLPSHVVDERNFRIVRAIQLSMQKTILPKEEW 254 S KYGL DD H+ D+ EAL RLP VVD R+ R+ RA+ LSM+ L + + Sbjct: 30 SRLRKYGLRYDDLYDPKHDL-DIKEALERLPREVVDARHQRLKRAMDLSMKHQYLSENDQ 88 Query: 255 TKYEEDSLYLTPIVEQVEKERLEREQ 332 + YL+ +++ V+KERLERE+ Sbjct: 89 AQQTPFRGYLSDMMDLVKKERLEREE 114 >07_01_0744 + 5687269-5687365,5687466-5687689,5688307-5688354, 5689057-5689125 Length = 145 Score = 48.0 bits (109), Expect = 3e-06 Identities = 27/57 (47%), Positives = 33/57 (57%), Gaps = 2/57 (3%) Frame = +3 Query: 84 SGFNKYGLLRDDCL--HETPDVTEALRRLPSHVVDERNFRIVRAIQLSMQKTILPKE 248 S KYGL DD + D+ EAL RLP VVD RN R+ RA+ LSM+ LP + Sbjct: 27 SRLRKYGLRYDDLYDPYHDLDIKEALARLPREVVDARNQRLKRAMDLSMKHQYLPAD 83 >08_01_0907 + 8949102-8949160,8949662-8949842,8951816-8951941, 8952082-8952092,8952237-8952360,8952447-8952546, 8952807-8952849,8953033-8953153 Length = 254 Score = 38.7 bits (86), Expect = 0.002 Identities = 21/52 (40%), Positives = 28/52 (53%) Frame = +3 Query: 96 KYGLLRDDCLHETPDVTEALRRLPSHVVDERNFRIVRAIQLSMQKTILPKEE 251 +Y L D + D+ EAL RLP VVD N R+ R + LS + LP +E Sbjct: 28 RYDDLFDAYQYHGLDIKEALARLPREVVDAHNQRLKRTMDLSTKHQYLPADE 79 >06_03_0540 - 21923763-21923945,21924027-21924776,21924895-21925323, 21925509-21925619,21925715-21926040,21926130-21926251, 21926905-21927020,21927119-21927243,21927338-21927596 Length = 806 Score = 32.7 bits (71), Expect = 0.12 Identities = 19/74 (25%), Positives = 36/74 (48%), Gaps = 3/74 (4%) Frame = +3 Query: 96 KYGLLRDDCLHETPDVTEALRR---LPSHVVDERNFRIVRAIQLSMQKTILPKEEWTKYE 266 K +L +C E V +AL R L V DE+ + ++ M KT+ +E ++K++ Sbjct: 353 KIKVLSSECTEEAKKVQDALHREELLKQKVADEKTRHLEAVTEVEMAKTLFAQEAFSKHK 412 Query: 267 EDSLYLTPIVEQVE 308 + + I E+ + Sbjct: 413 AEIVADMVIAEKTK 426 >11_06_0649 + 25882657-25882782,25882983-25883175,25883354-25884120 Length = 361 Score = 28.7 bits (61), Expect = 2.0 Identities = 17/55 (30%), Positives = 28/55 (50%) Frame = +3 Query: 177 VDERNFRIVRAIQLSMQKTILPKEEWTKYEEDSLYLTPIVEQVEKERLEREQWEK 341 +D +F +V L+ +K L KEEW + + + + +KE ERE+ EK Sbjct: 216 IDIYSFGVVMLEVLTGKKPYLFKEEWKEEKREKCEQDGKNTEEDKEESEREEEEK 270 >03_06_0102 + 31656268-31656304,31656625-31656920,31657967-31658080 Length = 148 Score = 27.9 bits (59), Expect = 3.5 Identities = 18/57 (31%), Positives = 30/57 (52%), Gaps = 1/57 (1%) Frame = +3 Query: 84 SGFNKYGLLRDDCLHETPDVTEALRRLPSHVVDERNFRIVRAI-QLSMQKTILPKEE 251 SG++K G+ +H TP EAL R+ + R R + + +LS+ I PK++ Sbjct: 46 SGYDKAGMDSGKYVHYTPGQVEALERVYAECPKPRFSRRQQLLCELSILANIEPKQK 102 >05_06_0025 + 25018426-25018596,25018692-25018892,25018983-25019236, 25019468-25019540,25019659-25019715,25020219-25020298, 25020386-25020448,25020678-25020765,25021055-25021156, 25021296-25021369,25021690-25021754,25021933-25022096, 25022179-25022246,25022337-25022397,25022729-25022766, 25023154-25023329,25023747-25023859,25023944-25023955 Length = 619 Score = 27.5 bits (58), Expect = 4.6 Identities = 18/42 (42%), Positives = 22/42 (52%), Gaps = 7/42 (16%) Frame = +3 Query: 84 SGF-NKYGLLRDDCLH------ETPDVTEALRRLPSHVVDER 188 +GF N YGL RDD E D+ ALR P H+V E+ Sbjct: 320 NGFINYYGLQRDDIREMREHYKEHGDIDMALRNFPRHLVAEK 361 >11_01_0771 + 6453130-6454488 Length = 452 Score = 27.1 bits (57), Expect = 6.1 Identities = 16/42 (38%), Positives = 20/42 (47%) Frame = +1 Query: 193 SVLYVPYSSPCKKQSYLKKSGQNMKKIPYT*PQLLSKLRKRG 318 +V VPY S Q G + K+ Y P+LL RKRG Sbjct: 241 AVADVPYMSSRSYQRVAVHDGFKVLKLRYRSPRLLRDKRKRG 282 >08_02_1154 - 24727668-24728275,24728503-24728844,24730216-24731119 Length = 617 Score = 27.1 bits (57), Expect = 6.1 Identities = 11/29 (37%), Positives = 20/29 (68%) Frame = +3 Query: 285 TPIVEQVEKERLEREQWEKEY*MRHGIVV 371 TP+V +V K+R E++ EK + HG+++ Sbjct: 322 TPLVARVVKQRREKKLKEKFFKQNHGLLL 350 >10_08_0672 + 19762340-19762432,19762543-19762735,19763225-19763269, 19763381-19763432,19763601-19763704,19763887-19763987, 19764225-19764283,19764536-19764592,19764944-19764989, 19765187-19765266,19766841-19767096,19767210-19767405, 19768368-19768448,19768536-19768587,19768759-19768862, 19769586-19769686,19769924-19769982,19770491-19770536, 19770789-19770868,19770953-19771013 Length = 621 Score = 26.6 bits (56), Expect = 8.1 Identities = 10/24 (41%), Positives = 17/24 (70%) Frame = -2 Query: 283 KYRESSSYFVHSSLGRIVFCMESC 212 K R S ++F+H++ +V C+ESC Sbjct: 246 KERYSVAFFLHTNPDLVVQCLESC 269 >07_03_1525 + 27448257-27448582,27450741-27450973,27451280-27452919, 27453129-27453575 Length = 881 Score = 26.6 bits (56), Expect = 8.1 Identities = 20/63 (31%), Positives = 30/63 (47%), Gaps = 8/63 (12%) Frame = +3 Query: 105 LLRDDCLHETPDVTE--------ALRRLPSHVVDERNFRIVRAIQLSMQKTILPKEEWTK 260 LLR+ CLH P++TE LR + ++D + I LS Q L EE+++ Sbjct: 707 LLRNMCLHAQPELTELDLKELSQTLREVLERIMDAEGAELEILIGLSSQICKLIPEEFSQ 766 Query: 261 YEE 269 E Sbjct: 767 QLE 769 >03_04_0140 + 17638335-17638583,17638843-17639061,17639206-17639443, 17640614-17640809,17640888-17640942,17641495-17641645, 17642501-17642809,17642950-17643215,17643311-17644237, 17644386-17644712 Length = 978 Score = 26.6 bits (56), Expect = 8.1 Identities = 14/55 (25%), Positives = 28/55 (50%) Frame = +3 Query: 183 ERNFRIVRAIQLSMQKTILPKEEWTKYEEDSLYLTPIVEQVEKERLEREQWEKEY 347 +R RI + L +K E+W + + + I E++++ +E +Q E+EY Sbjct: 522 DRLSRIEAELSLLKEKQKDLTEQWEREKSVMTKIQSIKEEIDRVNVEIQQAEREY 576 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 9,732,705 Number of Sequences: 37544 Number of extensions: 178532 Number of successful extensions: 613 Number of sequences better than 10.0: 12 Number of HSP's better than 10.0 without gapping: 596 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 612 length of database: 14,793,348 effective HSP length: 75 effective length of database: 11,977,548 effective search space used: 766563072 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -