BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= brP-0161 (419 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_58699| Best HMM Match : UCR_14kD (HMM E-Value=3.6e-37) 94 5e-20 SB_3002| Best HMM Match : Pkinase (HMM E-Value=4.1e-17) 31 0.39 SB_54614| Best HMM Match : Peptidase_A17 (HMM E-Value=1.2e-38) 29 1.2 SB_19540| Best HMM Match : Pro_isomerase (HMM E-Value=1.5e-23) 29 1.2 SB_36418| Best HMM Match : Ion_trans (HMM E-Value=3.5e-28) 29 2.1 SB_38133| Best HMM Match : TolA (HMM E-Value=0.38) 28 2.7 SB_44511| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 2.7 SB_28421| Best HMM Match : Oxysterol_BP (HMM E-Value=4.5e-11) 27 4.8 SB_53466| Best HMM Match : SCP (HMM E-Value=2.4e-27) 27 6.3 SB_56676| Best HMM Match : Peptidase_C1 (HMM E-Value=0.0027) 27 8.3 SB_40822| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.3 SB_25787| Best HMM Match : Asparaginase_2 (HMM E-Value=0.097) 27 8.3 >SB_58699| Best HMM Match : UCR_14kD (HMM E-Value=3.6e-37) Length = 116 Score = 93.9 bits (223), Expect = 5e-20 Identities = 44/98 (44%), Positives = 63/98 (64%) Frame = +3 Query: 51 SDSLSKWAYNLSGFNKYGLLRDDCLHETPDVTEALRRLPSHVVDERNFRIVRAIQLSMQK 230 S + +W G+ + GL R+D + E DV EA+RR+P + RNFRIVRAI +M+ Sbjct: 19 SAAFREWYIYACGYRQIGLKREDLIIEDSDVAEAVRRIPEEERNLRNFRIVRAIDTTMKM 78 Query: 231 TILPKEEWTKYEEDSLYLTPIVEQVEKERLEREQWEKE 344 LP+E WTK ED YL P++++V+ ER ERE W+K+ Sbjct: 79 KWLPEELWTKPSEDVPYLDPVIQKVKAERKERELWDKQ 116 >SB_3002| Best HMM Match : Pkinase (HMM E-Value=4.1e-17) Length = 683 Score = 31.1 bits (67), Expect = 0.39 Identities = 16/54 (29%), Positives = 29/54 (53%) Frame = +3 Query: 105 LLRDDCLHETPDVTEALRRLPSHVVDERNFRIVRAIQLSMQKTILPKEEWTKYE 266 LL + LH+ PD +AL + + + + FRI +A+ S +K I + + Y+ Sbjct: 343 LLAEPALHKDPDTIKALWKATVNELGDLEFRIQQAMTSSSKKPIAEEYSFLVYD 396 >SB_54614| Best HMM Match : Peptidase_A17 (HMM E-Value=1.2e-38) Length = 1935 Score = 29.5 bits (63), Expect = 1.2 Identities = 18/56 (32%), Positives = 28/56 (50%), Gaps = 3/56 (5%) Frame = +3 Query: 114 DDCLHETPDVTEALRRLPS--HVVDERNFRIVRAIQLSMQ-KTILPKEEWTKYEED 272 DDCLH TP EA+R ++ FR+ + + S + + LP+ E T +D Sbjct: 1166 DDCLHSTPTEAEAVRLATDLRELLARGGFRLTKFVSNSKELLSSLPESERTTSVKD 1221 >SB_19540| Best HMM Match : Pro_isomerase (HMM E-Value=1.5e-23) Length = 741 Score = 29.5 bits (63), Expect = 1.2 Identities = 16/45 (35%), Positives = 24/45 (53%), Gaps = 1/45 (2%) Frame = +3 Query: 216 LSMQKTILPKEEWTKYEEDSLYLTPIVEQVEKERLERE-QWEKEY 347 LS + T P + T E+D L L + Q EK+ ER+ +W + Y Sbjct: 102 LSSEPTQQPTKPLTVQEQDDLALAQALAQSEKDEAERKRRWGESY 146 >SB_36418| Best HMM Match : Ion_trans (HMM E-Value=3.5e-28) Length = 466 Score = 28.7 bits (61), Expect = 2.1 Identities = 16/38 (42%), Positives = 23/38 (60%) Frame = +3 Query: 216 LSMQKTILPKEEWTKYEEDSLYLTPIVEQVEKERLERE 329 LS KT LPKE+W K E++S P V Q ++ +R+ Sbjct: 8 LSPPKT-LPKEQWAKREKNSEGFKPGVMQEKRTLFKRD 44 >SB_38133| Best HMM Match : TolA (HMM E-Value=0.38) Length = 2114 Score = 28.3 bits (60), Expect = 2.7 Identities = 14/45 (31%), Positives = 27/45 (60%) Frame = +3 Query: 210 IQLSMQKTILPKEEWTKYEEDSLYLTPIVEQVEKERLEREQWEKE 344 I+ S+QKT PK++ + E+D E+ EK++ ++E E++ Sbjct: 1868 IEKSLQKTFHPKKKENEEEDDKKEKKEENEEEEKKKKKKENEEED 1912 >SB_44511| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 51 Score = 28.3 bits (60), Expect = 2.7 Identities = 14/42 (33%), Positives = 25/42 (59%) Frame = +3 Query: 219 SMQKTILPKEEWTKYEEDSLYLTPIVEQVEKERLEREQWEKE 344 S + +L ++E K EE + LTP ++ +LE+++ EKE Sbjct: 8 SNEHLLLNEKEPPKKEEPKIVLTPEEQEELDRKLEKQRMEKE 49 >SB_28421| Best HMM Match : Oxysterol_BP (HMM E-Value=4.5e-11) Length = 378 Score = 27.5 bits (58), Expect = 4.8 Identities = 10/31 (32%), Positives = 17/31 (54%) Frame = -2 Query: 193 KFLSSTTWDGSLRSASVTSGVSCKQSSRNKP 101 +++ +WD SL +GV+C RN+P Sbjct: 223 RYVIEGSWDKSLECIPQDTGVTCPTDCRNRP 253 >SB_53466| Best HMM Match : SCP (HMM E-Value=2.4e-27) Length = 5087 Score = 27.1 bits (57), Expect = 6.3 Identities = 25/78 (32%), Positives = 32/78 (41%) Frame = +3 Query: 129 ETPDVTEALRRLPSHVVDERNFRIVRAIQLSMQKTILPKEEWTKYEEDSLYLTPIVEQVE 308 ET V E L H +R V + + K + E EEDS I EQ E Sbjct: 2577 ETSTVQEVFVPLRDHSEKDREETTVISKSTLIHKVNVDATEVRSLEEDSEEY--IEEQEE 2634 Query: 309 KERLEREQWEKEY*MRHG 362 KE LER++ E + G Sbjct: 2635 KELLERKRRASEEELMQG 2652 >SB_56676| Best HMM Match : Peptidase_C1 (HMM E-Value=0.0027) Length = 295 Score = 26.6 bits (56), Expect = 8.3 Identities = 12/30 (40%), Positives = 14/30 (46%) Frame = -3 Query: 228 FAWRAVWHVQYGSFSRQQHGMEVCGVLQLH 139 F WR V Y S +R QH + CG H Sbjct: 55 FDWRDVNGTNYASTTRNQHIPQYCGSCWAH 84 >SB_40822| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 73 Score = 26.6 bits (56), Expect = 8.3 Identities = 17/46 (36%), Positives = 26/46 (56%) Frame = +3 Query: 237 LPKEEWTKYEEDSLYLTPIVEQVEKERLEREQWEKEY*MRHGIVVL 374 +P E TK +D + VEQ ++++ ERE+ +KE H I VL Sbjct: 27 IPISEPTKLPQD---VELAVEQYKRDKKERERLKKENDRLHAIEVL 69 >SB_25787| Best HMM Match : Asparaginase_2 (HMM E-Value=0.097) Length = 1623 Score = 26.6 bits (56), Expect = 8.3 Identities = 10/21 (47%), Positives = 14/21 (66%) Frame = -1 Query: 71 PFAEAVTSVNSRGSESHHGSC 9 PF A+T V+ RG++S G C Sbjct: 1130 PFRRAITCVSRRGNQSPTGGC 1150 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 11,480,114 Number of Sequences: 59808 Number of extensions: 216123 Number of successful extensions: 849 Number of sequences better than 10.0: 12 Number of HSP's better than 10.0 without gapping: 783 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 845 length of database: 16,821,457 effective HSP length: 75 effective length of database: 12,335,857 effective search space used: 789494848 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -