BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= brP-0160 (773 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value U40935-1|AAA81687.1| 1131|Caenorhabditis elegans Hypothetical pr... 29 4.9 Z68009-2|CAA92004.2| 891|Caenorhabditis elegans Hypothetical pr... 28 8.5 >U40935-1|AAA81687.1| 1131|Caenorhabditis elegans Hypothetical protein F31E3.4 protein. Length = 1131 Score = 28.7 bits (61), Expect = 4.9 Identities = 17/61 (27%), Positives = 32/61 (52%) Frame = +3 Query: 9 YNGQNVQVFGLDTSGSIVVTLAEGLLDEGRCMITDNYYTSDPLTEFMLSRNTDLCGTANK 188 ++G+ VQ+ + + S V + E ++ + +TD+ D LT+F DLC T ++ Sbjct: 925 FDGKTVQMRAVGRA-SCVDSTGERIIFDDHVKLTDDVEVVDYLTKFSGIVKADLCPTTSE 983 Query: 189 K 191 K Sbjct: 984 K 984 >Z68009-2|CAA92004.2| 891|Caenorhabditis elegans Hypothetical protein R09A8.2 protein. Length = 891 Score = 27.9 bits (59), Expect = 8.5 Identities = 21/79 (26%), Positives = 42/79 (53%) Frame = +1 Query: 139 QNLCFLAIQTSVAQPIKREKVYRKREGDKSILAAHETFKFKLRR*ERHIFWSFWARKNLD 318 QN+ +A + + AQ + +++E +S L H + + +R E+ FW ++ + Sbjct: 708 QNIDVIAFEETKAQLRESHGQMKEKERLRS-LDDHGSKESLSKRMEQERMKQFWQKEKHE 766 Query: 319 SSEDDAWDAAKTFLMKVDL 375 SS DDA + A +F+ +D+ Sbjct: 767 SSRDDANENA-SFVHSLDV 784 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 16,945,010 Number of Sequences: 27780 Number of extensions: 330196 Number of successful extensions: 953 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 928 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 953 length of database: 12,740,198 effective HSP length: 80 effective length of database: 10,517,798 effective search space used: 1861650246 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -