BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= brP-0160 (773 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value DQ026037-1|AAY87896.1| 431|Apis mellifera nicotinic acetylcholi... 24 1.8 AY338499-1|AAR08420.1| 500|Apis mellifera Kruppel-like protein ... 22 5.5 >DQ026037-1|AAY87896.1| 431|Apis mellifera nicotinic acetylcholine receptor alpha9subunit protein. Length = 431 Score = 23.8 bits (49), Expect = 1.8 Identities = 9/26 (34%), Positives = 15/26 (57%) Frame = -2 Query: 349 WQHPTHRLRMNRDSFLPKNSKKCVFL 272 W + THR R+N S++ + +FL Sbjct: 176 WPYDTHRCRINFGSWVHSGEEVNIFL 201 >AY338499-1|AAR08420.1| 500|Apis mellifera Kruppel-like protein 1 protein. Length = 500 Score = 22.2 bits (45), Expect = 5.5 Identities = 8/14 (57%), Positives = 9/14 (64%) Frame = -3 Query: 732 PVRCYVCGTR*AVP 691 P RC +CG AVP Sbjct: 91 PYRCNICGKTFAVP 104 Score = 21.8 bits (44), Expect = 7.3 Identities = 8/35 (22%), Positives = 14/35 (40%) Frame = +3 Query: 330 RCVGCCQNLLDEGRLAPYAQAKAKRVSTQCKICKK 434 +C C + + G+L + + CK C K Sbjct: 177 KCTVCSKTFIQSGQLVIHMRTHTGEKPYVCKACGK 211 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 202,762 Number of Sequences: 438 Number of extensions: 4028 Number of successful extensions: 6 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 4 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 6 length of database: 146,343 effective HSP length: 57 effective length of database: 121,377 effective search space used: 24275400 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -