BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= brP-0160 (773 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At2g38920.1 68415.m04784 SPX (SYG1/Pho81/XPR1) domain-containing... 32 0.37 At2g24230.1 68415.m02894 leucine-rich repeat transmembrane prote... 31 1.1 At4g02780.1 68417.m00378 copalyl diphosphate synthase / CPS / en... 29 3.4 At2g12290.1 68415.m01326 hypothetical protein 28 6.0 At5g57190.1 68418.m07144 phosphatidylserine decarboxylase, putat... 28 7.9 At4g16490.1 68417.m02496 armadillo/beta-catenin repeat family pr... 28 7.9 At2g17430.1 68415.m02011 seven transmembrane MLO family protein ... 28 7.9 >At2g38920.1 68415.m04784 SPX (SYG1/Pho81/XPR1) domain-containing protein / zinc finger (C3HC4-type RING finger) protein-related weak similarity to tripartite motif protein TRIM13 [Mus musculus] GI:12407427; contains Pfam profile PF03105: SPX domain, weak hit to PF00097: Zinc finger, C3HC4 type (RING finger) Length = 335 Score = 32.3 bits (70), Expect = 0.37 Identities = 15/53 (28%), Positives = 28/53 (52%) Frame = +3 Query: 270 LRKTHFLEFLGKKESRFIRRRCVGCCQNLLDEGRLAPYAQAKAKRVSTQCKIC 428 L K F+E+ K+ + + ++C C D+G++ P A + + S +CK C Sbjct: 19 LEKCRFVEY---KKLKKVLKKCKTCNSTKSDDGQIIPSATSSSLSDSCECKAC 68 >At2g24230.1 68415.m02894 leucine-rich repeat transmembrane protein kinase, putative Length = 853 Score = 30.7 bits (66), Expect = 1.1 Identities = 14/50 (28%), Positives = 24/50 (48%) Frame = -1 Query: 398 GFGLCIWSKSTFIKKVLAASHASSSDESRFFLAQKLQKMCLSQRRNLNLN 249 G GL W + F+ L SH + FF+++ ++M LS + N + Sbjct: 2 GLGLGFWGYALFLSLFLKQSHCQEPNTDGFFVSEFYKQMGLSSSQAYNFS 51 >At4g02780.1 68417.m00378 copalyl diphosphate synthase / CPS / ent-kaurene synthetase A (GA1) identical to GI:571330 [PMID: 7994182]; formerly called ent-kaurene synthetase A Length = 802 Score = 29.1 bits (62), Expect = 3.4 Identities = 13/45 (28%), Positives = 26/45 (57%) Frame = -1 Query: 383 IWSKSTFIKKVLAASHASSSDESRFFLAQKLQKMCLSQRRNLNLN 249 +W+KS+ + K +++S SSD R F Q + + ++R + + N Sbjct: 584 VWAKSSVLVKAISSSFGESSDSRRSFSDQFHEYIANARRSDHHFN 628 >At2g12290.1 68415.m01326 hypothetical protein Length = 133 Score = 28.3 bits (60), Expect = 6.0 Identities = 12/34 (35%), Positives = 18/34 (52%) Frame = +3 Query: 258 QVTPLRKTHFLEFLGKKESRFIRRRCVGCCQNLL 359 Q+TP ++HF + K RF + G C +LL Sbjct: 93 QLTPFHRSHFHPYKDNKRMRFPSNKEGGLCNSLL 126 >At5g57190.1 68418.m07144 phosphatidylserine decarboxylase, putative similar to SP|P53037 Phosphatidylserine decarboxylase proenzyme 2 precursor (EC 4.1.1.65) {Saccharomyces cerevisiae}; contains Pfam profile PF02666: phosphatidylserine decarboxylase Length = 615 Score = 27.9 bits (59), Expect = 7.9 Identities = 12/43 (27%), Positives = 23/43 (53%) Frame = -1 Query: 245 SCAARMLLSPSLFR*TFSLFIGCATEVCIARKHKFCQRVARVV 117 +C + LL P+ S+F+ CA E + + +F +R+ +V Sbjct: 124 TCKSFNLLDPTSSNVVGSIFLSCAIEDPVETERRFAKRILSIV 166 >At4g16490.1 68417.m02496 armadillo/beta-catenin repeat family protein contains Pfam profile: PF00514 armadillo/beta-catenin-like repeat Length = 268 Score = 27.9 bits (59), Expect = 7.9 Identities = 11/40 (27%), Positives = 19/40 (47%) Frame = -2 Query: 382 YGASRPSSRRFWQHPTHRLRMNRDSFLPKNSKKCVFLSGV 263 YG+S PS+ R + +R R +F + C F+ + Sbjct: 23 YGSSSPSAARLHRQAGRSMRTVRSNFYQSGDQSCSFVGSI 62 >At2g17430.1 68415.m02011 seven transmembrane MLO family protein / MLO-like protein 7 (MLO7) identical to membrane protein Mlo7 [Arabidopsis thaliana] gi|14091584|gb|AAK53800; similar to MLO protein SWISS-PROT:P93766, NCBI_gi:1877221 [Hordeum vulgare][Barley] Length = 542 Score = 27.9 bits (59), Expect = 7.9 Identities = 10/28 (35%), Positives = 20/28 (71%) Frame = -2 Query: 241 VLLECFCLLLSFGKPFLFLLAVPQRSVL 158 ++L LLL+FG+P++ + VP+++ L Sbjct: 86 MILGFISLLLTFGEPYILKICVPRKAAL 113 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 15,802,004 Number of Sequences: 28952 Number of extensions: 302285 Number of successful extensions: 819 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 798 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 819 length of database: 12,070,560 effective HSP length: 80 effective length of database: 9,754,400 effective search space used: 1726528800 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -